DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr5

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:232 Identity:106/232 - (45%)
Similarity:136/232 - (58%) Gaps:16/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SNLL--------PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTS 105
            |||:        |.||....|.:...:|.|..|||||..|||:.|||||:|||||||.|..|||:
  Fly    78 SNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTN 142

  Fly   106 DQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKT 170
            ||||.....|.|..|.|:|...|.||:||||||::||||:||:|...||..||:|....:|.:::
  Fly   143 DQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQS 207

  Fly   171 GSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMP 235
            ||||||||...|.|....::.|:|.:|::.       ||:...||||.: ....||.|.|.|...
  Fly   208 GSDINLTCIAPQAPGPYTHMLWHKDTELVS-------DSARGGIRVESE-QQMKTSNLVISRVQH 264

  Fly   236 GDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSS 272
            .|:|||||....:.:.||:||:|..|..|||||...|
  Fly   265 TDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 52/94 (55%)
IG_like 60..150 CDD:214653 51/89 (57%)
IG_like 163..257 CDD:214653 34/93 (37%)
Ig 174..244 CDD:143165 26/69 (38%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 52/95 (55%)
IG_like 98..179 CDD:214653 45/80 (56%)
IG_like 206..278 CDD:214653 30/79 (38%)
Ig 211..278 CDD:143165 27/74 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.