DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Ama

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:261 Identity:61/261 - (23%)
Similarity:99/261 - (37%) Gaps:61/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPSRANIGLLNWLIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTV 65
            |....|.::..|..|||.:..|::.|           ....|...||          .:.:::..
  Fly     1 MQYNKRPDMARLRLLIGLIFCLAISL-----------DSVLSAPVIS----------QISKDVVA 44

  Fly    66 TVGQTGFLHCRVERLGDKDVSWIRK---RDLH--ILTAGGTTYTSDQRFQVLRPD----GSANWT 121
            :||.:...:|.||.:|...|||.::   .|.:  :|:........|||:.|...:    |||.:|
  Fly    45 SVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYT 109

  Fly   122 LQIKYPQPRDSGVYECQ--INTEPKMS--LSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQ 182
            .:|:..:..|.|.||||  ::...|::  ||.......:.|| ..|...:|..|.::.|||    
  Fly   110 FRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAE-NTPKSTLVTEGQNLELTC---- 169

  Fly   183 GPHELG----NIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC 243
              |..|    .|.|.:....:...|.:.:.....|||             .:.|.   |.|.|.|
  Fly   170 --HANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIR-------------SVHRM---DRGGYYC 216

  Fly   244 V 244
            :
  Fly   217 I 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/107 (27%)
IG_like 60..150 CDD:214653 29/102 (28%)
IG_like 163..257 CDD:214653 19/86 (22%)
Ig 174..244 CDD:143165 15/73 (21%)
AmaNP_731114.2 I-set 33..143 CDD:254352 31/119 (26%)
Ig 37..127 CDD:299845 25/89 (28%)
IG_like 154..234 CDD:214653 19/86 (22%)
IGc2 161..223 CDD:197706 17/79 (22%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.