DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr16

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:306 Identity:88/306 - (28%)
Similarity:126/306 - (41%) Gaps:83/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLPYFDFDV-PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLR- 113
            |||.....: |.|.||..||..:|.|::.:...|.:||:|.||.||:....||:.:|.||..|. 
  Fly   195 LLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQ 259

  Fly   114 -------------------------------PDG-------SANWTLQIKYPQPRDSGVYECQIN 140
                                           |.|       |.:|||||||....|:|.||||:.
  Fly   260 STTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLA 324

  Fly   141 TEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGN-IFWYKGSEMLDGKGE 204
            ||||||......|:..:.|:.|.....||.||.:.|.| |::|..|... ||||:|.:.:  ..|
  Fly   325 TEPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHC-IVRGTLEAPKYIFWYRGDQQV--TAE 386

  Fly   205 NEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDT--------------------GNYTCVPTVAK 249
            ||...:      :..|      ..:|.|.:.|.|                    |||||.|..:.
  Fly   387 NEASGA------QSGW------YTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSA 439

  Fly   250 TSSVYVHVIIGEH-------PAAMQHNSSSNSNSFYCGICCMLLSI 288
            .:|:.:||:.||:       .||..|.......|.:..:..:|:::
  Fly   440 AASMQLHVLSGEYSASAIKSTAARPHRLGHGYTSLHQWLIFLLVAL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 37/124 (30%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 3/7 (43%)
CDR1 77..83 CDD:409355 0/5 (0%)
Ig strand C 84..90 CDD:409355 2/5 (40%)
CDR2 93..109 CDD:409355 5/15 (33%)
Ig strand D 109..114 CDD:409355 2/36 (6%)
FR3 110..147 CDD:409355 22/75 (29%)
Ig strand E 119..125 CDD:409355 4/5 (80%)
Ig strand F 133..148 CDD:409355 11/14 (79%)
CDR3 148..160 CDD:409355 1/11 (9%)
IG_like 163..257 CDD:214653 29/114 (25%)
Ig strand B 174..178 CDD:409355 1/3 (33%)
Ig strand C 189..193 CDD:409355 2/4 (50%)
Ig strand E 226..230 CDD:409355 0/3 (0%)
Ig strand F 240..244 CDD:409355 3/3 (100%)
dpr16NP_001287169.1 IG_like 352..447 CDD:214653 29/109 (27%)
Ig strand B 358..362 CDD:409353 1/3 (33%)
Ig strand C 373..377 CDD:409353 2/3 (67%)
Ig strand E 416..420 CDD:409353 0/3 (0%)
Ig strand F 430..435 CDD:409353 4/4 (100%)

Return to query results.
Submit another query.