DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and LSAMP

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:328 Identity:77/328 - (23%)
Similarity:119/328 - (36%) Gaps:103/328 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPR---NLTVTVGQTGFLHCRVERLGDK 83
            |.:||||  ...|.||.             ||....|..|   |:||..|.|..|.|.||....|
Human    12 LPLVLLR--LLCLLPTG-------------LPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSK 61

  Fly    84 DVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLS 148
             |:|:.:..  |:.||...::.|.|.: |....|..::|:|:.....|.|.|.|.:.|:.:...|
Human    62 -VAWLNRSG--IIFAGHDKWSLDPRVE-LEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTS 122

  Fly   149 YTFNVVELKAEIFG-PSDLMVKTGSDINLTCKIMQGPHELGNIFW---------YKGSE------ 197
            ..:.:|::..:|.. .||:.|..||::.|.|.....|..:  |.|         ::|.|      
Human   123 QVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPV--ITWRHLTPTGREFEGEEEYLEIL 185

  Fly   198 --------MLDGKGENEIDSS-MARIRV------------EDDWTDGLTSRLKIK-RAMPG---- 236
                    ..:.|..||:.|: :.:::|            .::.|.|..:.||.: .|:|.    
Human   186 GITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFE 250

  Fly   237 ----DT-----------------------------GNYTCVPT----VAKTSSVYVHVIIGEHPA 264
                ||                             ||||||..    |...|.|....::...|.
Human   251 WYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPH 315

  Fly   265 AMQ 267
            .:|
Human   316 PIQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 28/97 (29%)
IG_like 60..150 CDD:214653 28/92 (30%)
IG_like 163..257 CDD:214653 34/171 (20%)
Ig 174..244 CDD:143165 24/143 (17%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 27/93 (29%)
Ig 132..215 CDD:386229 18/84 (21%)
Ig_3 219..294 CDD:372822 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.