Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
Alignment Length: | 333 | Identity: | 76/333 - (22%) |
---|---|---|---|
Similarity: | 116/333 - (34%) | Gaps: | 118/333 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 W-LIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRV 77
Fly 78 ERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTE 142
Fly 143 PKMSLSYTFNVVELKAEIFGPSDL---------MVKTGSDINLTCKIMQGPHELGNIFWYKGSEM 198
Fly 199 LDG-------------------------KGENEIDS-----------SMARIRVEDDW---TDG- 223
Fly 224 --------------------------LTSR-----------LKIKRAMPGDTGNYTCVP--TVAK 249
Fly 250 TSSVYVHV 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 28/94 (30%) |
IG_like | 60..150 | CDD:214653 | 27/89 (30%) | ||
IG_like | 163..257 | CDD:214653 | 33/181 (18%) | ||
Ig | 174..244 | CDD:143165 | 25/146 (17%) | ||
CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | 30/96 (31%) |
Ig | 56..116 | CDD:143165 | 21/66 (32%) | ||
IG_like | 144..221 | CDD:214653 | 12/79 (15%) | ||
IGc2 | 151..209 | CDD:197706 | 12/60 (20%) | ||
IG_like | 232..313 | CDD:214653 | 16/82 (20%) | ||
Ig | 242..311 | CDD:143165 | 13/69 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12424 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |