DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and CG7166

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:333 Identity:76/333 - (22%)
Similarity:116/333 - (34%) Gaps:118/333 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 W-LIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRV 77
            | |:.:|...|:.|:.|........||||:...:|..:|           ..|.||:|..|.|:|
  Fly     9 WTLVLYLFSFSLSLIGGSFILPENDPPTTAPKFLSRGHL-----------YKVIVGETIELPCKV 62

  Fly    78 ERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTE 142
            :.||...:.|  ::...:||||....|.||||:::     .::.|||...:.:|:|.|.||:..:
  Fly    63 QNLGSFVLLW--RKGSSVLTAGHLKITRDQRFKIV-----GDYNLQINGVKTQDAGDYICQLGDQ 120

  Fly   143 PKMSLSYTFNVVELKAEIFGPSDL---------MVKTGSDINLTCKIMQGPHELGNIFWYKGSEM 198
            ......:|       .||..|..|         ..:.||.:.|.||....|  :..|||:| .::
  Fly   121 ENRDQVHT-------VEILVPPTLRALPHNGQVTARKGSTVTLECKASGNP--VPTIFWFK-KDV 175

  Fly   199 LDG-------------------------KGENEIDS-----------SMARIRVEDDW---TDG- 223
            ..|                         ..:|.:..           |...|.||..|   ::| 
  Fly   176 FSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASEGY 240

  Fly   224 --------------------------LTSR-----------LKIKRAMPGDTGNYTCVP--TVAK 249
                                      .|.|           |.|:...|.|.|||:||.  .:.:
  Fly   241 DVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVADNALGR 305

  Fly   250 TSSVYVHV 257
            |.. |:.|
  Fly   306 TKK-YIEV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 28/94 (30%)
IG_like 60..150 CDD:214653 27/89 (30%)
IG_like 163..257 CDD:214653 33/181 (18%)
Ig 174..244 CDD:143165 25/146 (17%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 30/96 (31%)
Ig 56..116 CDD:143165 21/66 (32%)
IG_like 144..221 CDD:214653 12/79 (15%)
IGc2 151..209 CDD:197706 12/60 (20%)
IG_like 232..313 CDD:214653 16/82 (20%)
Ig 242..311 CDD:143165 13/69 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.