Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094842.1 | Gene: | IGLON5 / 402665 | HGNCID: | 34550 | Length: | 336 | Species: | Homo sapiens |
Alignment Length: | 218 | Identity: | 56/218 - (25%) |
---|---|---|---|
Similarity: | 86/218 - (39%) | Gaps: | 42/218 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 AALAPTPPTTSTTTISPSNLLPYFDFDVPR-NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHI 95
Fly 96 LTAGGTTYTSDQRFQVL--RPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKA 158
Fly 159 EIFG-PSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDG-KGENEIDSSMARIRVEDDWT 221
Fly 222 DGLTSRLKIKRAMPGDTGNYTCV 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 25/97 (26%) |
IG_like | 60..150 | CDD:214653 | 25/92 (27%) | ||
IG_like | 163..257 | CDD:214653 | 20/83 (24%) | ||
Ig | 174..244 | CDD:143165 | 15/70 (21%) | ||
IGLON5 | NP_001094842.1 | Ig | 41..129 | CDD:416386 | 24/93 (26%) |
Ig strand A' | 41..46 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 48..56 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
FR2 | 61..68 | CDD:409353 | 2/7 (29%) | ||
Ig strand C | 61..67 | CDD:409353 | 2/6 (33%) | ||
CDR2 | 69..79 | CDD:409353 | 4/11 (36%) | ||
Ig strand C' | 71..74 | CDD:409353 | 2/2 (100%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 11/37 (30%) | ||
Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 0/8 (0%) | ||
FR4 | 122..129 | CDD:409353 | 0/6 (0%) | ||
Ig_3 | 134..199 | CDD:404760 | 21/88 (24%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 162..170 | CDD:409353 | 1/12 (8%) | ||
Ig strand F | 191..199 | CDD:409353 | 4/6 (67%) | ||
Ig strand G | 202..212 | CDD:409353 | |||
Ig_3 | 217..295 | CDD:404760 | |||
putative Ig strand A | 218..224 | CDD:409353 | |||
Ig strand B | 234..238 | CDD:409353 | |||
Ig strand C | 247..251 | CDD:409353 | |||
Ig strand E | 274..278 | CDD:409353 | |||
Ig strand F | 288..293 | CDD:409353 | |||
Ig strand G | 301..304 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |