DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and rplp0

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_012813704.1 Gene:rplp0 / 394664 XenbaseID:XB-GENE-976211 Length:315 Species:Xenopus tropicalis


Alignment Length:183 Identity:41/183 - (22%)
Similarity:57/183 - (31%) Gaps:36/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTV 247
            || |..:.|...|......:|..||.|.:..|:..|.......:.|.:....|...|  ..:..|
 Frog   132 GP-EKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSYG--LIIQQV 193

  Fly   248 AKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAALAK 312
            ....|:|       .|..:.....:....|..|:    .::.|.|||..|.|.....|:.     
 Frog   194 YDNGSIY-------SPEVLDITEEALHVRFLEGV----RNVASVCLQIGYPTVASVPHSV----- 242

  Fly   313 SAGLGPPKRATLTTSETGIS--------------AAEVAAAAGASAAVASALA 351
               :...||......||..|              :|.|.||..|..|.|.|.|
 Frog   243 ---INGYKRVLAIAVETDYSFPLADKVKAFLADPSAFVVAAPAADVAAAPAAA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845
IG_like 60..150 CDD:214653
IG_like 163..257 CDD:214653 17/73 (23%)
Ig 174..244 CDD:143165 14/60 (23%)
rplp0XP_012813704.1 Ribosomal_L10_P0 <76..315 CDD:381979 41/183 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.