DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr10

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:276 Identity:103/276 - (37%)
Similarity:139/276 - (50%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGS 117
            ||||..:|||:|..||::.:|.|||:.||:|.|:|||.|||||||.|..|||:|||||.......
  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117

  Fly   118 ANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVEL-------------------------- 156
            ..||||||:.|.||:|||||||:|:|..|.|...|:|:|                          
  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182

  Fly   157 --------------------KAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDG 201
                                .|.|.|..||.|..||.|||||.|...|....:||||...::|..
  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSE 247

  Fly   202 KGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAM 266
                  ::|..|::.:...::...|.|.|..|....:|.|:|.|:..:.:|:.|||:.||.|.||
  Fly   248 ------ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAM 306

  Fly   267 QHNSSSNSNSFYCGIC 282
            |.|::..:.:..|..|
  Fly   307 QTNAAPAAVALACWSC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 54/94 (57%)
IG_like 60..150 CDD:214653 53/89 (60%)
IG_like 163..257 CDD:214653 29/93 (31%)
Ig 174..244 CDD:143165 20/69 (29%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 47/79 (59%)
IG_like 210..297 CDD:214653 29/92 (32%)
IGc2 217..287 CDD:197706 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.