DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and VSIG8

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001013683.1 Gene:VSIG8 / 391123 HGNCID:32063 Length:414 Species:Homo sapiens


Alignment Length:302 Identity:65/302 - (21%)
Similarity:101/302 - (33%) Gaps:78/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RFQVLRP---DGSAN-WTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMV 168
            ||....|   |.|.| ..||:.     |:..|||::.   |.:::....:|.::|.   |:..|.
Human    98 RFAASDPSQYDASINLMNLQVS-----DTATYECRVK---KTTMATRKVIVTV
QAR---PAVPMC 151

  Fly   169 KT------GSDINLTCKIMQGPHEL--------GNIFWYKGSEMLD------------------G 201
            .|      |:|:.|.|....|...|        |:.:.|:......                  .
Human   152 WTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSIN 216

  Fly   202 KGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAM 266
            :|.|..|..:..|...|   |||     .:..:..:.|...||..|..:.|..:.||||....::
Human   217 QGLNNGDLVLKDISRAD---DGL-----YQCTVANNVGYSVCVVEVKVSDSRRIGVIIGIVLGSL 273

  Fly   267 QHNSSSNSNSFYCGICCMLLSI---VSCCLQHFYETGCGYLHAAAALAKSAGLGPPKRATLTTSE 328
                        ..:.|:.:.|   |.||..   .:|.|....|.......|:|......|.:..
Human   274 ------------LALGCLAVGIWGLVCCCCG---GSGAGGARGAFGYGNGGGVGGGACGDLASEI 323

  Fly   329 TGISAAEVAAAAGASAAVASALA--TCNM---LRERPAAIRC 365
            ...:.|....|:|..:.|...|.  |.|:   ||.:.|...|
Human   324 REDAVAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKYAPPPC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 13/49 (27%)
IG_like 60..150 CDD:214653 13/45 (29%)
IG_like 163..257 CDD:214653 24/125 (19%)
Ig 174..244 CDD:143165 15/95 (16%)
VSIG8NP_001013683.1 V-set 35..142 CDD:311561 14/51 (27%)
IG_like 160..256 CDD:214653 20/103 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.