DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr13

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:244 Identity:90/244 - (36%)
Similarity:136/244 - (55%) Gaps:8/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSA 118
            ||..:....:|..:|.|..:.|.|..:|:..||||||:|.|:||.|.|||:||:||.......|.
  Fly   176 YFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSE 240

  Fly   119 NWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQG 183
            :||||||:.|.||:||||||::|.|..|:....:|||.:|||.||....:..||.:.|.|:::|.
  Fly   241 DWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQN 305

  Fly   184 PHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVA 248
            ......||||..:.|::    .:||..: .:..|.|:.   :|.|.|:|.....:||:|||.:..
  Fly   306 TEASEYIFWYHDNRMIN----YDIDRGI-NVSTEPDFQ---SSELTIQRTRREHSGNFTCVASNT 362

  Fly   249 KTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFY 297
            :.:||.||:..|::||||.|.....|.........|::.|::...:.|:
  Fly   363 QPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLHMIMIIIASGYRIFH 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 43/94 (46%)
IG_like 60..150 CDD:214653 43/89 (48%)
IG_like 163..257 CDD:214653 27/93 (29%)
Ig 174..244 CDD:143165 19/69 (28%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 43/95 (45%)
IG_like 182..262 CDD:214653 40/79 (51%)
IG_like 285..362 CDD:214653 24/84 (29%)
IGc2 292..361 CDD:197706 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.