DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Dscam2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:357 Identity:82/357 - (22%)
Similarity:129/357 - (36%) Gaps:76/357 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDG 116
            |||... :|: :|...|:|..|.|.|.....:::.|.|         ||.....|.| |.::|||
  Fly   520 LPYIRL-IPK-VTAVSGETLNLKCPVAGYPIEEIHWER---------GGRELPDDIR-QRVQPDG 572

  Fly   117 SANWTLQIKYPQPR-DSGVYECQINTEPKMSLSYTFNV---VELKAEIFGPSDLMVKTGSDINLT 177
            |    |.|...|.. |||||.|....:...|...:..|   |..|...|..:.|.:..|...:||
  Fly   573 S----LTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLT 633

  Fly   178 CKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYT 242
            |.:::|...| .|.|.|....:|......:..           .|...|.|.|:......||||:
  Fly   634 CSVVKGDLPL-TINWRKDGRPIDPTQHMSVKQ-----------VDQYNSILVIENLGSDHTGNYS 686

  Fly   243 CV-----PTVAKTSSVYVHV----IIGEHPAAMQHN---------------------SSSNSNSF 277
            ||     ..|..:.::.|:|    |:....|.::.|                     ::.:.:..
  Fly   687 CVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGE 751

  Fly   278 YCGI----CCMLLSIVSCCLQHFYETGCGYLHAAAALAKSAGLGPPKRATLTTSETGISAAEVAA 338
            |..:    ...||...|..|||..|...|:....|......|:|       ...:..::::...:
  Fly   752 YEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIG-------KVIQLKVNSSPYFS 809

  Fly   339 AAGASAAVA---SALATCNMLRERPAAIRCLR 367
            :...|..|.   :||..|.:..::|..|..:|
  Fly   810 STSRSVMVKKGDTALLQCAVSGDKPINIVWMR 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/98 (30%)
IG_like 60..150 CDD:214653 28/90 (31%)
IG_like 163..257 CDD:214653 23/98 (23%)
Ig 174..244 CDD:143165 17/69 (25%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 31/104 (30%)
IGc2 533..597 CDD:197706 25/77 (32%)
Ig 630..699 CDD:143165 20/80 (25%)
IG_like 714..802 CDD:214653 14/94 (15%)
Ig 725..802 CDD:299845 12/83 (14%)
Ig 823..894 CDD:143165 6/19 (32%)
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.