| Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009289749.1 | Gene: | dscamb / 386937 | ZFINID: | ZDB-GENE-031118-67 | Length: | 2020 | Species: | Danio rerio |
| Alignment Length: | 327 | Identity: | 66/327 - (20%) |
|---|---|---|---|
| Similarity: | 106/327 - (32%) | Gaps: | 125/327 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRD-----LHILTAG---------------GTTY- 103
Fly 104 --------TSDQRFQVLRPDG-------------------------------SANWT-------- 121
Fly 122 -------------------LQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPS--- 164
Fly 165 ---DLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTS 226
Fly 227 RLKIKRAMPGDTGNYTCVPTVAKTSSVY--VHVIIGEHPAAMQHNSSSNSNSFYCG----ICCML 285
Fly 286 LS 287 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 30/180 (17%) |
| IG_like | 60..150 | CDD:214653 | 29/176 (16%) | ||
| IG_like | 163..257 | CDD:214653 | 23/101 (23%) | ||
| Ig | 174..244 | CDD:143165 | 17/69 (25%) | ||
| dscamb | XP_009289749.1 | I-set | 132..198 | CDD:254352 | |
| I-set | 225..310 | CDD:254352 | |||
| IGc2 | 239..300 | CDD:197706 | |||
| IG_like | 320..400 | CDD:214653 | 13/79 (16%) | ||
| IGc2 | 328..391 | CDD:197706 | 10/62 (16%) | ||
| IG_like | 417..501 | CDD:214653 | 13/89 (15%) | ||
| Ig | 424..498 | CDD:143165 | 13/79 (16%) | ||
| IG_like | 511..592 | CDD:214653 | 24/96 (25%) | ||
| IGc2 | 518..576 | CDD:197706 | 20/73 (27%) | ||
| I-set | 595..685 | CDD:254352 | 10/29 (34%) | ||
| Ig | 612..682 | CDD:143165 | 3/9 (33%) | ||
| I-set | 689..785 | CDD:254352 | |||
| Ig7_DSCAM | 706..785 | CDD:143211 | |||
| IG_like | 795..883 | CDD:214653 | |||
| Ig | 803..890 | CDD:299845 | |||
| FN3 | 887..980 | CDD:238020 | |||
| FN3 | 987..1084 | CDD:238020 | |||
| FN3 | 1092..1185 | CDD:238020 | |||
| FN3 | 1190..1279 | CDD:238020 | |||
| IGc2 | 1302..1367 | CDD:197706 | |||
| FN3 | 1398..1471 | CDD:238020 | |||
| FN3 | 1485..1557 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||