DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and ImpL2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:192 Identity:45/192 - (23%)
Similarity:68/192 - (35%) Gaps:63/192 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IRKRDLHIL---------------TAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYEC 137
            :|.|..||:               |...|.|.|    .|:.|..|:..|.:..||     |..:.
  Fly   119 VRVRSSHIIDHVLSEARTYTCVGRTGSKTIYAS----TVVHPPRSSRLTPEKTYP-----GAQKP 174

  Fly   138 QINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGK 202
            :|....|..|                 |||   ||:|.|.|::...|.  ..|.|      |:.:
  Fly   175 RIIYTEKTHL-----------------DLM---GSNIQLPCRVHARPR--AEITW------LNNE 211

  Fly   203 GENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVP--TVAK-TSSVYVHVIIGE 261
            .:..:.....|:....|.   |.|.:|.:     |.|||.|:.  .|.| |:..:|:.::.|
  Fly   212 NKEIVQGHRHRVLANGDL---LISEIKWE-----DMGNYKCIARNVVGKDTADTFVYPVLNE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 18/80 (23%)
IG_like 60..150 CDD:214653 18/76 (24%)
IG_like 163..257 CDD:214653 26/96 (27%)
Ig 174..244 CDD:143165 16/69 (23%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.