DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Gm1123

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001074245.1 Gene:Gm1123 / 382097 MGIID:2685969 Length:390 Species:Mus musculus


Alignment Length:291 Identity:66/291 - (22%)
Similarity:102/291 - (35%) Gaps:77/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRV----ERLGDKD 84
            ||.|.|:......|....|.:..:|.           :.:....|:|..|.|..    |..|..|
Mouse     1 MVFLLGFLFLCGVTDHIGSVSITTPE-----------QTIQEVQGETVHLPCMFTLSPEDQGPLD 54

  Fly    85 VSWIR-------KRDLHILTAGGTTYTSDQRFQVLRPD--GSANWT----------LQIKYPQPR 130
            :.|:|       ..| |::    ..|..|:.:.....|  |..|:|          ::|:..||.
Mouse    55 IEWLRLSGPNNEAMD-HVI----ILYAVDKIYSDFYQDMRGRVNFTSNGITSGEASIKIRDVQPA 114

  Fly   131 DSGVYECQINTEP---KMSLSYTFNVVEL--KAEIFGPSDLMVK-TGSDINLTCKIM-----QGP 184
            |||.|.|::.|.|   |.::..|  ||:.  ...|..|...:.| .|..::|.|...     |||
Mouse   115 DSGTYLCKVKTAPGVAKTTVQLT--VVDYIGSVSITTPEQTIEKDQGETVHLPCMFTFISKDQGP 177

  Fly   185 HELGNIFWYKGSEMLDGKGENEIDSSM---ARIRVEDDWTDGLTSR--------------LKIKR 232
            .   ||.|.:    |.|.....:|..:   :..::.||....|..|              :.|..
Mouse   178 L---NIEWLR----LSGPNNEAMDHVVILYSADKIHDDVYPDLKGRVYFTSNDIKSGDASINITN 235

  Fly   233 AMPGDTGNYTC-VPTVAKTSSVYVHVIIGEH 262
            ....|.|.|.| |.|...|.:..:.:.:.:|
Mouse   236 VQLSDAGTYQCKVKTYPGTVNRNLQLAVTDH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/120 (24%)
IG_like 60..150 CDD:214653 28/115 (24%)
IG_like 163..257 CDD:214653 26/117 (22%)
Ig 174..244 CDD:143165 20/92 (22%)
Gm1123NP_001074245.1 V-set 24..139 CDD:284989 30/132 (23%)
IG_like 25..138 CDD:214653 30/130 (23%)
V-set 149..264 CDD:284989 26/121 (21%)
IG_like 152..263 CDD:214653 25/117 (21%)
V-set 274..389 CDD:284989
IG_like 277..388 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.