DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Gm5150

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001075156.1 Gene:Gm5150 / 381484 MGIID:3779469 Length:299 Species:Mus musculus


Alignment Length:260 Identity:53/260 - (20%)
Similarity:90/260 - (34%) Gaps:71/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERL---GD 82
            :|.::||.|...|..     .....|.|.           ::::|..|.:..|:|.|..|   | 
Mouse    14 VLLLILLLGLKGAAG-----KELKVIQPE-----------KSVSVRAGGSATLNCTVTSLLPVG- 61

  Fly    83 KDVSWIR----KRDL-------HILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYE 136
             .:.|.|    :|:|       |.......:.|:::|        :.::::.|.|....|:|.|.
Mouse    62 -PIRWYRGVGHRRNLIYSYTGEHFPRITNVSDTTNRR--------NLDFSICISYVTFADAGTYY 117

  Fly   137 C----QINTEPKMSLS-------YTFNVVELKAEIFGP-SDLMVKTGSDINLTCKIMQ----GPH 185
            |    :..:||.:.:.       :.......:.::..| ..:.|:.|....|.|.:..    || 
Mouse   118 CVKFQKGPSEPDIEIQSGGGTELFVLGAAGKELKVIQPEKSVSVRAGGLATLNCTVTSLIPVGP- 181

  Fly   186 ELGNIFWYKGSEMLDGKGENEIDS----SMARIRVEDDWTD--GLTSRLKIKRAMPGDTGNYTCV 244
                :.||:|.    |...|.|.|    ...||....|.|.  .|...::|......|...|.||
Mouse   182 ----MRWYRGV----GHRRNLIYSYTGEHFPRITNVSDATKRRNLDFSIRISDVTFADADTYYCV 238

  Fly   245  244
            Mouse   239  238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 22/119 (18%)
IG_like 60..150 CDD:214653 22/114 (19%)
IG_like 163..257 CDD:214653 24/93 (26%)
Ig 174..244 CDD:143165 19/79 (24%)
Gm5150NP_001075156.1 Ig 32..143 CDD:386229 24/131 (18%)
Ig 151..262 CDD:386229 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12440
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.