DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr20

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:249 Identity:70/249 - (28%)
Similarity:113/249 - (45%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDFDVPR-----NLTVTVGQTGFLHCRVERLGDKDVSWIRKRD----------LHILTAGGTT 102
            |:|: ||.|     ||||..|.:..|:||:..|.||.|||:|...          |.:||.|..|
  Fly   265 PHFE-DVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHT 328

  Fly   103 YTSDQRFQV--LRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSD 165
            ||.|:|:::  ..|:   ||.|:|...:..|..:|||||:|.|.       .|:::...:..|..
  Fly   329 YTGDKRYKMEFQYPN---NWRLKITNVKKDDEAIYECQISTHPP-------RVIQINLHVNAPKV 383

  Fly   166 LMV------------KTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVED 218
            ::|            :..|.:.|:|.:.........:||.....:|:      .|.:...:.|:.
  Fly   384 MIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILN------YDVTRGGVSVKT 442

  Fly   219 D-WTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSS 271
            : ..||..|.|.|.:....|:|||||..:..:..::.||::.||..|.:.|..:
  Fly   443 ELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGA 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 39/111 (35%)
IG_like 60..150 CDD:214653 38/106 (36%)
IG_like 163..257 CDD:214653 22/106 (21%)
Ig 174..244 CDD:143165 17/70 (24%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 34/89 (38%)
Ig 279..378 CDD:299845 37/108 (34%)
Ig 400..471 CDD:299845 19/76 (25%)
IG_like 402..480 CDD:214653 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.