DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and CG13506

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:185 Identity:40/185 - (21%)
Similarity:68/185 - (36%) Gaps:56/185 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYP 127
            :::.:||. ::.|....: |.||.             ||.|..|:                  |.
  Fly    13 ISLLIGQL-YVSCAGSPI-DADVK-------------GTDYQDDE------------------YE 44

  Fly   128 QPRDSGVYECQINTEPKMSLSYTFNVVELKA-EIFGPSDLMV--KTGSDINLTCKIMQGPHELGN 189
            ...|:...:.||       :..|.|..|.:| ..|..:||.|  |.|.|:.|.|....  .:|.|
  Fly    45 YGDDTDDDDTQI-------IDVTKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARN--FQLSN 100

  Fly   190 -IFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC 243
             :.||| :.::...|:|.|...:..:         |.:.:.::...|.|:.:|.|
  Fly   101 AVVWYK-NRIIIANGQNPISQRVQCM---------LNNSILLRNVSPEDSDDYYC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 16/90 (18%)
IG_like 60..150 CDD:214653 14/86 (16%)
IG_like 163..257 CDD:214653 21/84 (25%)
Ig 174..244 CDD:143165 15/71 (21%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 19/79 (24%)
IGc2 83..146 CDD:197706 17/75 (23%)
IG_like 176..254 CDD:214653
Ig 176..239 CDD:299845
I-set 258..349 CDD:254352
Ig 275..348 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.