DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr1h

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001011884.1 Gene:nitr1h / 368781 ZFINID:ZDB-GENE-041001-84 Length:339 Species:Danio rerio


Alignment Length:256 Identity:46/256 - (17%)
Similarity:88/256 - (34%) Gaps:76/256 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DFDVPRNLTVTVGQTGF---------LHCRVERLGDKDVSWIR----KRDLHILTAGGT------ 101
            ||||.:...|.:.:.|:         .|.:::::      |.:    .:.|.|::..|:      
Zfish    33 DFDVVQEDNVKIVEAGWDVKFTCTFSWHAQLKKV------WFKLTNNGKSLQIVSLYGSQKPSWN 91

  Fly   102 -TYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFN------VVELKAE 159
             .:.:..||...:.|...|  |.|......||..|.|.:::.....:.....      |.:.|..
Zfish    92 PKFENKNRFIAAKGDNFFN--LTILKTTLSDSATYYCVVSSYQATGMGSGTRLLVRDAVADRKRT 154

  Fly   160 IFGPSDLMVKTGSDINLTCKIM----QGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDW 220
            :.......|.:|..:.|.|.|.    .|.|   :::|:|   .:.|..|..:            :
Zfish   155 LHQSLIDNVDSGDSVYLQCSIFTESCAGDH---SVYWFK---QISGDSEGVL------------Y 201

  Fly   221 TDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGI 281
            |.|..:. :.|.:....|  .:||.::.|.:.                 |.|:|..:||.:
Zfish   202 TKGERNG-RCKNSTESQT--QSCVYSLHKNNI-----------------SRSDSGIYYCAV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 18/120 (15%)
IG_like 60..150 CDD:214653 17/109 (16%)
IG_like 163..257 CDD:214653 18/97 (19%)
Ig 174..244 CDD:143165 13/73 (18%)
nitr1hNP_001011884.1 V-set 45..145 CDD:284989 16/107 (15%)
IG_like 45..144 CDD:214653 16/106 (15%)
IG_like 163..242 CDD:214653 23/116 (20%)
V-set 166..258 CDD:284989 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.