DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and LRIT3

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:461 Identity:86/461 - (18%)
Similarity:126/461 - (27%) Gaps:202/461 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGD 82
            |..||.|.|||..:.       ..:..|..|:..|.|.                           
Human   122 WASLLDMPLLRTLDL-------HNNKITSVPNEALRYL--------------------------- 152

  Fly    83 KDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVY------------ 135
            |:::::   ||           |..|...|.||...:||..:..|    |||.            
Human   153 KNLAYL---DL-----------SSNRLTTLPPDFLESWTHLVSTP----SGVLDLSPSRIILGLQ 199

  Fly   136 ------ECQIN----------------------TEPKMSLSYTFNVVELK-----AEIFGPSDLM 167
                  :|.|:                      :||:......|...||:     :.:...:.:|
Human   200 DNPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIM 264

  Fly   168 VKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDD-------WT---- 221
            ...||::.|.|.....|  ...|.|.:.            |||.....|..:       |:    
Human   265 SALGSNVLLRCDATGFP--TPQITWTRS------------DSSPVNYTVIQESPEEGVRWSIMSL 315

  Fly   222 DGLTSRLKIKRAMPGDTGNYTC-VPTVAKTSSVYVHVII----------------GEHPAAMQHN 269
            .|::|:         |.|:|.| ...:|..|...|.|.:                |:||......
Human   316 TGISSK---------DAGDYKCKAKNLAGMSEAVVTVTVLGITTTPIPPDTSERTGDHPEWDVQP 371

  Fly   270 SSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAALAKSAGLGPPKRATL---------- 324
            .|..|.|            ||....:.:.:.    .:..:...::.|.||..|:.          
Human   372 GSGRSTS------------VSSASSYLWSSS----FSPTSSFSASTLSPPSTASFSLSPFSSSTV 420

  Fly   325 ---TTSETGISAAEVAA-------------------------AAGASAAVASALATCNMLRERPA 361
               ||..|.|||:...|                         .|..|.....||....||.|..|
Human   421 SSTTTLSTSISASTTMANKRSFQLHQGGKRNLKVAKNGSKLPPASTSKKEELALLDQTMLTETNA 485

  Fly   362 AIRCLR 367
            ||..||
Human   486 AIENLR 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 19/134 (14%)
IG_like 60..150 CDD:214653 18/129 (14%)
IG_like 163..257 CDD:214653 22/105 (21%)
Ig 174..244 CDD:143165 16/81 (20%)
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566
LRR 2 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3 104..128 3/5 (60%)
LRR_8 105..165 CDD:290566 15/90 (17%)
LRR_4 105..146 CDD:289563 8/30 (27%)
leucine-rich repeat 107..130 CDD:275378 4/7 (57%)
LRR 4 129..151 6/28 (21%)
LRR_4 131..170 CDD:289563 12/86 (14%)
leucine-rich repeat 131..154 CDD:275378 6/56 (11%)
LRR 5 152..175 8/63 (13%)
leucine-rich repeat 155..168 CDD:275378 4/26 (15%)
Ig 267..345 CDD:299845 22/100 (22%)
IG_like 267..345 CDD:214653 22/100 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 4/23 (17%)
FN3 486..550 CDD:214495 4/6 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.