DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:251 Identity:67/251 - (26%)
Similarity:99/251 - (39%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WLLLLSMVLLRGYNAALAPTPPTTSTTTISP-SNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLG 81
            |||||..|..              |..:.|. :|..|.|...: .|.||.||:...|.|.|..|.
  Fly     9 WLLLLQSVCF--------------SQASFSELNNSDPKFSGPI-NNSTVPVGRDALLTCVVHDLV 58

  Fly    82 DKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEP-KM 145
            ...|:|:|.....||:......|.:.|..:...:... |.|:|:..|..|.|.|.|||||:| |.
  Fly    59 SFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRI-WQLKIRDVQESDRGWYMCQINTDPMKS 122

  Fly   146 SLSYTFNVVELKAEIFGPS-DLMVKTGSDINLTCKIMQGPHELGNIFWYKGSE---MLDGKGENE 206
            .:.|...||......:..| |::..||.::.|||.....|  :..|.|.:...   ::...|:.|
  Fly   123 QMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVP--MPTITWRREEATPILISDDGDRE 185

  Fly   207 IDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------PTVAKTSSVYVH 256
            :.|           .:|  ..|.:.:......|.|.|:      |||:|...:.|:
  Fly   186 VFS-----------VEG--QNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 31/95 (33%)
IG_like 60..150 CDD:214653 30/90 (33%)
IG_like 163..257 CDD:214653 23/104 (22%)
Ig 174..244 CDD:143165 13/72 (18%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 30/86 (35%)
Ig 39..122 CDD:299845 29/83 (35%)
Ig 132..213 CDD:299845 18/95 (19%)
IG_like 141..227 CDD:214653 22/100 (22%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.