| Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
| Alignment Length: | 213 | Identity: | 64/213 - (30%) |
|---|---|---|---|
| Similarity: | 92/213 - (43%) | Gaps: | 43/213 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 62 NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSAN-----WT 121
Fly 122 LQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFG---PSDLMVKTGSDINLTCKIMQG 183
Fly 184 PHELGNIFWYKGS----EMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV 244
Fly 245 ------PTVAKTSSVYVH 256 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 36/96 (38%) |
| IG_like | 60..150 | CDD:214653 | 36/92 (39%) | ||
| IG_like | 163..257 | CDD:214653 | 25/104 (24%) | ||
| Ig | 174..244 | CDD:143165 | 15/73 (21%) | ||
| DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | 36/95 (38%) |
| IG_like | 51..137 | CDD:214653 | 36/91 (40%) | ||
| IG_like | 153..237 | CDD:214653 | 23/101 (23%) | ||
| Ig | 161..224 | CDD:299845 | 18/80 (23%) | ||
| IG_like | 252..335 | CDD:214653 | |||
| Ig | 258..333 | CDD:143165 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||