Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
Alignment Length: | 213 | Identity: | 64/213 - (30%) |
---|---|---|---|
Similarity: | 92/213 - (43%) | Gaps: | 43/213 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSAN-----WT 121
Fly 122 LQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFG---PSDLMVKTGSDINLTCKIMQG 183
Fly 184 PHELGNIFWYKGS----EMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV 244
Fly 245 ------PTVAKTSSVYVH 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 36/96 (38%) |
IG_like | 60..150 | CDD:214653 | 36/92 (39%) | ||
IG_like | 163..257 | CDD:214653 | 25/104 (24%) | ||
Ig | 174..244 | CDD:143165 | 15/73 (21%) | ||
DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | 36/95 (38%) |
IG_like | 51..137 | CDD:214653 | 36/91 (40%) | ||
IG_like | 153..237 | CDD:214653 | 23/101 (23%) | ||
Ig | 161..224 | CDD:299845 | 18/80 (23%) | ||
IG_like | 252..335 | CDD:214653 | |||
Ig | 258..333 | CDD:143165 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |