DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr2

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:332 Identity:135/332 - (40%)
Similarity:175/332 - (52%) Gaps:75/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTT 102
            ||  ..||..|    |.|||.:|||:|...|.|..::|||:.||||.|||||||||||||||..|
  Fly    97 PP--EETTYPP----PVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILT 155

  Fly   103 YTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVV----ELKAEIFGP 163
            ||||:||:|:|...|.:|||.:||.||||||:||||:|||||:|:::..||:    :.||.|.||
  Fly   156 YTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGP 220

  Fly   164 SDLMVKTGSDINLTCKIMQ---GPHELGNIFWYKGSEMLDG--KGENEIDSSMARIRVEDDWTDG 223
            :||.||.||.:.|||.:.|   ...::|.|:||:|..:|..  ...|:....:.||.:|....:.
  Fly   221 TDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEK 285

  Fly   224 LTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQ--------------------- 267
            |.|||:|..|...|||||||:||.|:.:||.|:||..|.|||||                     
  Fly   286 LQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLA 350

  Fly   268 ---------------------HNSSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAALA 311
                                 |:|.||.::.:...|.:...|.|    |..|..|          
  Fly   351 MVASSVVRWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAKITS----HLKEHRC---------- 401

  Fly   312 KSAGLGP 318
                |||
  Fly   402 ----LGP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 55/84 (65%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 2/7 (29%)
CDR1 77..83 CDD:409355 3/5 (60%)
Ig strand C 84..90 CDD:409355 4/5 (80%)
CDR2 93..109 CDD:409355 12/15 (80%)
Ig strand D 109..114 CDD:409355 2/4 (50%)
FR3 110..147 CDD:409355 23/36 (64%)
Ig strand E 119..125 CDD:409355 3/5 (60%)
Ig strand F 133..148 CDD:409355 11/14 (79%)
CDR3 148..160 CDD:409355 4/15 (27%)
IG_like 163..257 CDD:214653 40/98 (41%)
Ig strand B 174..178 CDD:409355 1/3 (33%)
Ig strand C 189..193 CDD:409355 1/3 (33%)
Ig strand E 226..230 CDD:409355 3/3 (100%)
Ig strand F 240..244 CDD:409355 3/3 (100%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 59/92 (64%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 3/5 (60%)
FR2 137..151 CDD:409355 12/13 (92%)
Ig strand C 137..143 CDD:409355 4/5 (80%)
Ig strand C' 149..153 CDD:409355 3/3 (100%)
CDR2 153..162 CDD:409355 5/8 (63%)
Ig strand D 162..167 CDD:409355 2/4 (50%)
FR3 163..192 CDD:409355 17/28 (61%)
Ig strand E 172..178 CDD:409355 3/5 (60%)
Ig strand F 186..192 CDD:409355 4/5 (80%)
IG_like 220..306 CDD:214653 33/85 (39%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 2/2 (100%)
Ig strand F 302..307 CDD:409353 4/4 (100%)
Ig strand G 310..313 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.