DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:332 Identity:135/332 - (40%)
Similarity:175/332 - (52%) Gaps:75/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTT 102
            ||  ..||..|    |.|||.:|||:|...|.|..::|||:.||||.|||||||||||||||..|
  Fly    97 PP--EETTYPP----PVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILT 155

  Fly   103 YTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVV----ELKAEIFGP 163
            ||||:||:|:|...|.:|||.:||.||||||:||||:|||||:|:::..||:    :.||.|.||
  Fly   156 YTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGP 220

  Fly   164 SDLMVKTGSDINLTCKIMQ---GPHELGNIFWYKGSEMLDG--KGENEIDSSMARIRVEDDWTDG 223
            :||.||.||.:.|||.:.|   ...::|.|:||:|..:|..  ...|:....:.||.:|....:.
  Fly   221 TDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEK 285

  Fly   224 LTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQ--------------------- 267
            |.|||:|..|...|||||||:||.|:.:||.|:||..|.|||||                     
  Fly   286 LQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLA 350

  Fly   268 ---------------------HNSSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAALA 311
                                 |:|.||.::.:...|.:...|.|    |..|..|          
  Fly   351 MVASSVVRWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAKITS----HLKEHRC---------- 401

  Fly   312 KSAGLGP 318
                |||
  Fly   402 ----LGP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 60/94 (64%)
IG_like 60..150 CDD:214653 59/89 (66%)
IG_like 163..257 CDD:214653 40/98 (41%)
Ig 174..244 CDD:143165 26/74 (35%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 59/92 (64%)
Ig 116..192 CDD:299845 49/75 (65%)
ig 220..306 CDD:278476 33/85 (39%)
IG_like 220..306 CDD:214653 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104656at50557
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
77.070

Return to query results.
Submit another query.