DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr3

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:347 Identity:131/347 - (37%)
Similarity:165/347 - (47%) Gaps:106/347 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 APTPPTTSTTTISPSNL------------------------------------------------ 51
            :|:||..|.:..|||:.                                                
  Fly   160 SPSPPAASASASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDAKRERSGAADE 224

  Fly    52 ----------LPYFDFDVPRNLTVTVGQT-GFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTS 105
                      ||.|||.:|||:|...|.| ..:.|||:.|.||.|||||||||||||.|..||||
  Fly   225 ESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTS 289

  Fly   106 DQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVEL----KAEIFGPSDL 166
            |:||||.....|..|||.:|.|..:|||:||||:|||||||:::..|::|:    ||.|.||.||
  Fly   290 DKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDL 354

  Fly   167 MVKTGSDINLTCKIMQ-GPHELGNIFWYKGSEMLD-------------GKGE------------- 204
            ..|.||.|.|.|.:.| ...::|.|:||:|..|:.             |:||             
  Fly   355 HFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPND 419

  Fly   205 --NEIDSSM---ARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPA 264
              :|:|..|   .||.:|....|.|.|||:|..|...|||||||.||.|.::||.||||..|:||
  Fly   420 IMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPA 484

  Fly   265 AMQHNSSSNSNSFYCGIC-CML 285
            |||.:          |.| |.|
  Fly   485 AMQKS----------GACPCAL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 56/95 (59%)
IG_like 60..150 CDD:214653 55/90 (61%)
IG_like 163..257 CDD:214653 45/125 (36%)
Ig 174..244 CDD:143165 32/101 (32%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 53/86 (62%)
IG_like 243..329 CDD:214653 52/85 (61%)
Ig 350..464 CDD:299845 39/113 (35%)
IG_like <441..477 CDD:214653 20/35 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104656at50557
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.