DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:114/277 - (41%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVP-RNLTVTVGQTGFLHCRVER 79
            |.|.|||  :||.|....|..:...:|.....|       ||.:| .|:|:..|:.....|.|..
  Fly    68 IRWQLLL--LLLLGNCIDLTVSNKISSVGAFEP-------DFVIPLENVTIAQGRDATFTCVVNN 123

  Fly    80 LGDKDVS-----------WIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSG 133
            ||...||           ||:.....||.......|::.|..|...|.: .|||.|:..:..|:|
  Fly   124 LGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYN-TWTLNIRGVKMEDAG 187

  Fly   134 VYECQINTEPKMSLSYTFNVVELKAEIFG---PSDLMVKTGSDINLTCKIMQGPHELGNIFWYK- 194
            .|.||:||:|....:.|..|| :..:|..   ..|:||..|....|.|: .:| |....|.|.: 
  Fly   188 KYMCQVNTDPMKMQTATLEVV-IPPDIINEETSGDMMVPEGGSAKLVCR-ARG-HPKPKITWRRE 249

  Fly   195 -GSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------PTVAKTSS 252
             |.|::...|.::...:.:   ||.:    :.:..||.|:   :.|.|.|:      |||:|...
  Fly   250 DGREIIARNGSHQKTKAQS---VEGE----MLTLSKITRS---EMGAYMCIASNGVPPTVSKRMK 304

  Fly   253 VYVHVIIGEHPAAMQHN 269
            :.||.    ||.....|
  Fly   305 LQVHF----HPLVQVPN 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 31/106 (29%)
IG_like 60..150 CDD:214653 30/101 (30%)
IG_like 163..257 CDD:214653 26/101 (26%)
Ig 174..244 CDD:143165 16/71 (23%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 36/119 (30%)
ig 102..195 CDD:278476 27/93 (29%)
IG_like 219..307 CDD:214653 25/99 (25%)
Ig 221..307 CDD:299845 25/97 (26%)
Ig 311..404 CDD:299845 2/7 (29%)
IG_like 327..405 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.