DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and AgaP_AGAP009245

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_553184.3 Gene:AgaP_AGAP009245 / 3291935 VectorBaseID:AGAP009245 Length:203 Species:Anopheles gambiae


Alignment Length:239 Identity:88/239 - (36%)
Similarity:118/239 - (49%) Gaps:64/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TPP----TTST----------TTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSW 87
            |||    .||:          |..||.:..||||....||:|..||.|.:|:|||..||::.|||
Mosquito    10 TPPKHYYQTSSFDDNEINDDGTAKSPLDRGPYFDISASRNVTALVGNTAYLNCRVRNLGNRTVSW 74

  Fly    88 IRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFN 152
            ||.||||:||.|..|||||||:|.:......:|:|::.|||.||||||||||:|.|.:..|.|.:
Mosquito    75 IRHRDLHLLTVGKATYTSDQRYQSVHNPQLDDWSLKVLYPQQRDSGVYECQISTTPPVGYSMTLS 139

  Fly   153 VVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVE 217
            |                   :||                               .||....:.|.
Mosquito   140 V-------------------EIN-------------------------------YDSPRGGVSVI 154

  Fly   218 DDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGE 261
            .:..|..||.|.|:||...|:|.|||:|::|..::|:|||:.|:
Mosquito   155 TEKGDITTSYLLIQRARSTDSGKYTCLPSMANPTTVHVHVLNGK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 51/94 (54%)
IG_like 60..150 CDD:214653 50/89 (56%)
IG_like 163..257 CDD:214653 21/93 (23%)
Ig 174..244 CDD:143165 16/69 (23%)
AgaP_AGAP009245XP_553184.3 Ig 47..140 CDD:299845 51/92 (55%)
IG_like 47..140 CDD:214653 51/92 (55%)
IG_like 127..>180 CDD:214653 20/102 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X190
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.