DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and DIP-kappa

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:261 Identity:70/261 - (26%)
Similarity:107/261 - (40%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLSMVLLRGYNAALAPTP-----PTTSTTTISPSNLLPYFDFDVPR------NLTVTVGQTGFL 73
            |.::::........:..||     |:....|...:......|.|.||      |:||:||:...:
  Fly    29 LAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALM 93

  Fly    74 HCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQ 138
            .|.||.|....|:|:|.....||:......:.:.|..:...| ..:|.|.||..:..|.|.|.||
  Fly    94 ACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYND-HRSWYLHIKEVEETDRGWYMCQ 157

  Fly   139 INTEPKMSLSYTFNVV--ELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYK--GSEML 199
            :||:|..|......||  .:..|....:|::|:.|.:|:|.||....|...  :.|.:  |.|||
  Fly   158 VNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPY--VMWRREDGEEML 220

  Fly   200 DGKGE--NEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------PTVAKTSSVYVH 256
            .| ||  |.:|..:..|.        ..|||.:        ..|.||      |:::|.    ||
  Fly   221 IG-GEHVNVVDGELLHIT--------KVSRLHM--------AAYLCVASNGVPPSISKR----VH 264

  Fly   257 V 257
            :
  Fly   265 L 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 27/90 (30%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 1/7 (14%)
CDR1 77..83 CDD:409355 3/5 (60%)
Ig strand C 84..90 CDD:409355 2/5 (40%)
CDR2 93..109 CDD:409355 2/15 (13%)
Ig strand D 109..114 CDD:409355 0/4 (0%)
FR3 110..147 CDD:409355 13/36 (36%)
Ig strand E 119..125 CDD:409355 2/5 (40%)
Ig strand F 133..148 CDD:409355 8/14 (57%)
CDR3 148..160 CDD:409355 2/13 (15%)
IG_like 163..257 CDD:214653 28/103 (27%)
Ig strand B 174..178 CDD:409355 2/3 (67%)
Ig strand C 189..193 CDD:409355 0/3 (0%)
Ig strand E 226..230 CDD:409355 3/3 (100%)
Ig strand F 240..244 CDD:409355 1/3 (33%)
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 30/92 (33%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 30/113 (27%)
Ig strand B 195..199 CDD:409301 2/3 (67%)
Ig strand C 208..212 CDD:409301 0/5 (0%)
Ig strand E 232..236 CDD:409301 0/3 (0%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 1/6 (17%)
IG_like 282..368 CDD:214653
Ig strand B 288..292 CDD:409353
Ig strand C 301..305 CDD:409353
Ig strand E 330..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.