DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:261 Identity:70/261 - (26%)
Similarity:107/261 - (40%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLSMVLLRGYNAALAPTP-----PTTSTTTISPSNLLPYFDFDVPR------NLTVTVGQTGFL 73
            |.::::........:..||     |:....|...:......|.|.||      |:||:||:...:
  Fly    29 LAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALM 93

  Fly    74 HCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQ 138
            .|.||.|....|:|:|.....||:......:.:.|..:...| ..:|.|.||..:..|.|.|.||
  Fly    94 ACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYND-HRSWYLHIKEVEETDRGWYMCQ 157

  Fly   139 INTEPKMSLSYTFNVV--ELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYK--GSEML 199
            :||:|..|......||  .:..|....:|::|:.|.:|:|.||....|...  :.|.:  |.|||
  Fly   158 VNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPY--VMWRREDGEEML 220

  Fly   200 DGKGE--NEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------PTVAKTSSVYVH 256
            .| ||  |.:|..:..|.        ..|||.:        ..|.||      |:::|.    ||
  Fly   221 IG-GEHVNVVDGELLHIT--------KVSRLHM--------AAYLCVASNGVPPSISKR----VH 264

  Fly   257 V 257
            :
  Fly   265 L 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 31/100 (31%)
IG_like 60..150 CDD:214653 31/95 (33%)
IG_like 163..257 CDD:214653 28/103 (27%)
Ig 174..244 CDD:143165 20/73 (27%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 29/92 (32%)
IG_like 82..174 CDD:214653 30/92 (33%)
IG_like 184..267 CDD:214653 29/105 (28%)
IGc2 191..255 CDD:197706 23/82 (28%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.