DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Jaml

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_038938277.1 Gene:Jaml / 315610 RGDID:1562572 Length:379 Species:Rattus norvegicus


Alignment Length:401 Identity:83/401 - (20%)
Similarity:148/401 - (36%) Gaps:96/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLLSMVLLR-GYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGD 82
            |:::.:||:. ||...|    |..:.:::               .|.|.||::..:.|.|:...:
  Rat     7 LIVIPVVLVSVGYPQGL----PDLTVSSL---------------KLRVHVGESALMGCVVQSTEE 52

  Fly    83 K---DVSWIRKRDLH-----ILTAGGTTYTSDQRFQ--------VLRPDGSANWTLQIKYPQPRD 131
            |   .|.|:..:..|     :|....:......|||        :||.|||    |.::..|..|
  Rat    53 KPVDKVDWVFSKGEHAENEYVLYYYSSLSVPTGRFQNRSRLVGDLLRNDGS----LLLQDVQKAD 113

  Fly   132 SGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTC---------------KIM 181
            .|:|.|:|..:.:.|:|..|.::.:..|  .|.:|.|..|..|.:.|               ...
  Rat   114 EGIYTCEIRLKNEGSVSKKFVLLHVLPE--EPKELRVHVGDPIQMGCFFRSTEERRVTRVNWMFS 176

  Fly   182 QGPHELGNIF------WYKGSEMLDGKGENEID--SSMARIRVEDDWTDGLTSRLKIKRAMPGDT 238
            .|.|....|.      .:.|:....|:..|.:|  ..::|       .||......:|::   |.
  Rat   177 SGKHAQEEIVLSYDFNMHSGTFQGQGRFRNRVDLTGDISR-------NDGSIMLQTVKKS---DQ 231

  Fly   239 GNYTCVPTVAKTSS---VYVHVIIGEHPAAMQHNSSS----------NSNSFYCGICCMLLSIVS 290
            |.|||...:.|..|   :.:|||..|.|.::...:.:          |......||.|..|.::.
  Rat   232 GVYTCSIYLGKLESRKTIVLHVIQDESPRSISTTTETAGKQQGILDGNQLVIIVGIVCATLLLLP 296

  Fly   291 CCLQHFYETGCGYLHAAAALAKSAGLGPPKRATLTTSE----TGISAAEVAAAAGASAAVASALA 351
            ..:....:|...    .::::..|.:...:....|:||    :.|:..|.|....:..:.|:.:.
  Rat   297 VLILIVKKTKWN----KSSVSSIASVKSLENKEKTSSEKHVYSSITTWETAERGPSGESEATYMT 357

  Fly   352 TCNMLRERPAA 362
            ...:.|..|.|
  Rat   358 MHPVWRSSPKA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/110 (26%)
IG_like 60..150 CDD:214653 28/105 (27%)
IG_like 163..257 CDD:214653 24/119 (20%)
Ig 174..244 CDD:143165 17/92 (18%)
JamlXP_038938277.1 V-set 33..139 CDD:400157 29/109 (27%)
FR2 58..69 CDD:409353 3/10 (30%)
CDR2 70..82 CDD:409353 1/11 (9%)
Ig strand C' 71..77 CDD:409353 1/5 (20%)
Ig strand C' 78..82 CDD:409353 0/3 (0%)
FR3 87..121 CDD:409353 13/37 (35%)
Ig strand D 90..96 CDD:409353 0/5 (0%)
Ig strand E 100..108 CDD:409353 4/11 (36%)
Ig strand F 115..122 CDD:409353 3/6 (50%)
V-set 141..253 CDD:400157 25/123 (20%)
Ig strand A' 144..150 CDD:409353 2/5 (40%)
Ig strand B 152..162 CDD:409353 2/9 (22%)
CDR1 162..169 CDD:409353 0/6 (0%)
Ig strand C 169..176 CDD:409353 0/6 (0%)
FR2 170..181 CDD:409353 1/10 (10%)
CDR2 182..196 CDD:409353 1/13 (8%)
Ig strand C' 183..189 CDD:409353 1/5 (20%)
Ig strand C' 191..196 CDD:409353 0/4 (0%)
FR3 204..238 CDD:409353 11/43 (26%)
Ig strand D 207..213 CDD:409353 1/5 (20%)
Ig strand E 217..225 CDD:409353 2/7 (29%)
Ig strand F 232..238 CDD:409353 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.