DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:222 Identity:55/222 - (24%)
Similarity:92/222 - (41%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRP 114
            |..|.|....|:.:....|.:..:.|.........|:|:::         ||..::..::||  .
  Rat   136 NAPPTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKE---------GTLLSASGKYQV--S 189

  Fly   115 DGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFG-PSDLMVKTGSDINLTC 178
            |||    |.:......|.|.|.|:..:....::..|..:|:....|.. |.::.|....|..|||
  Rat   190 DGS----LTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTC 250

  Fly   179 KIMQGPHELGNI--FWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNY 241
            :....|   ||:  .||...|.:..:.:.::     |:|:..|.|      |.|.|..|.|.|.|
  Rat   251 RAEAYP---GNLTYTWYWQDENVYFQNDLKL-----RVRILIDGT------LIIFRVKPEDAGKY 301

  Fly   242 TCVPT----VAKTSSVYVHVIIGEHPA 264
            ||||:    .:.::|.|:.|   ::||
  Rat   302 TCVPSNSLGRSPSASAYLTV---QYPA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 18/94 (19%)
IG_like 60..150 CDD:214653 17/89 (19%)
IG_like 163..257 CDD:214653 29/99 (29%)
Ig 174..244 CDD:143165 21/71 (30%)
Igsf9bNP_001363879.1 PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Ig 41..115 CDD:319273
I-set 139..225 CDD:369462 20/100 (20%)
Ig 229..321 CDD:386229 30/105 (29%)
Ig <353..414 CDD:386229
Ig 438..502 CDD:319273
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.