DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Mxra8

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_038966047.1 Gene:Mxra8 / 313770 RGDID:1359356 Length:466 Species:Rattus norvegicus


Alignment Length:455 Identity:86/455 - (18%)
Similarity:159/455 - (34%) Gaps:144/455 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIGWLLLLSMVLLRGYNAALAPTPPTT---STTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCR 76
            |:..:||..:|||:. :|.|:...|.|   |::.:|.|            .::...|....|.|:
  Rat     3 LLSRVLLWKLVLLQS-SAVLSSGSPGTAAASSSVVSES------------AVSWAAGTQAVLRCQ 54

  Fly    77 VERL-GDKDVSWIRKRDLHILTAGG---------TTYTSDQRFQVLRP--------------DGS 117
            ..|: ..:|....|:|.:|...:||         ..|::.:: :|.:|              || 
  Rat    55 SPRMVWTQDRLHDRQRVVHWDLSGGPGSQGRRLVDMYSAGEQ-RVYQPRDRDRLLLSPSAFHDG- 117

  Fly   118 ANWTLQIKYPQPRDSGVYEC-----------------QINTEPKMSLSYTFNVVELKAEIFGPSD 165
             |::|.|:..:..|.|||.|                 ::..:|.:|.:|.....|:         
  Rat   118 -NFSLLIRAVERGDEGVYTCNLHHHYCHLYESLAVRLEVTDDPLLSRAYWDGEKEV--------- 172

  Fly   166 LMVKTGSDINLTC----------------KIMQGPHELGNIFWYKGSEMLD--GKGENEI----- 207
            |:|..|:...:||                :::....:|..:...:...:||  ..||...     
  Rat   173 LVVALGAPALMTCVNREHLWTDRHLEEAQQVVHWDRQLPGVPHDRADRLLDLYASGERRAYGPPF 237

  Fly   208 --------DSSMAR----IRVED-DWTD-------------GLTSR----LKI--------KRAM 234
                    .::.||    :|::| :..|             ||..|    |::        .||.
  Rat   238 LRDRVSVNTNAFARGDFSLRIDDLEPADEGIYSCHLHHHYCGLHERRVFHLRVTEPVFEPPARAS 302

  Fly   235 PGDTGNYTCV----PTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCG---ICCMLLSIVSCC 292
            ||:...:..|    ||:|:..|: ::||:.|     .|........:...   :..:||..|...
  Rat   303 PGNGSGHNSVPSPDPTMARGHSI-INVIVPE-----DHTHFFQQLGYVLATLLLFILLLITVVLA 361

  Fly   293 LQHFYETGCGYLHAAAALAKSAGLGPPKRATLTTSETGISAAEVAAAAGASAAV-ASALATCNML 356
            .:|.:..||......|..:|...:...:.|..|..:......::....|....| ...:..||::
  Rat   362 TRHRHSGGCKTSDRKAGKSKGKDVNMVEFAVATRDQAPYRTEDIQLGRGEGQRVQGKYIFECNLI 426

  Fly   357  356
              Rat   427  426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/135 (19%)
IG_like 60..150 CDD:214653 25/130 (19%)
IG_like 163..257 CDD:214653 28/158 (18%)
Ig 174..244 CDD:143165 20/130 (15%)
Mxra8XP_038966047.1 V-set 43..156 CDD:400157 23/115 (20%)
Ig strand B 47..54 CDD:409353 1/6 (17%)
CDR1 55..62 CDD:409353 1/6 (17%)
FR2 69..84 CDD:409353 4/14 (29%)
Ig strand C 69..76 CDD:409353 2/6 (33%)
CDR2 86..100 CDD:409353 2/14 (14%)
Ig strand C' 87..92 CDD:409353 0/4 (0%)
Ig strand C' 97..100 CDD:409353 1/2 (50%)
FR3 103..144 CDD:409353 10/42 (24%)
Ig strand D 106..112 CDD:409353 0/5 (0%)
Ig strand E 118..124 CDD:409353 2/5 (40%)
Ig strand F 133..144 CDD:409353 3/10 (30%)
CDR3 145..147 CDD:409353 0/1 (0%)
Ig strand G 147..155 CDD:409353 0/7 (0%)
V-set 171..291 CDD:400157 20/128 (16%)
CDR2 219..239 CDD:409353 4/19 (21%)
Ig strand C' 220..226 CDD:409353 2/5 (40%)
Ig strand C' 231..234 CDD:409353 0/2 (0%)
FR3 240..271 CDD:409353 5/30 (17%)
Ig strand D 241..244 CDD:409353 0/2 (0%)
Ig strand E 252..261 CDD:409353 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.