DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Fas2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:191 Identity:43/191 - (22%)
Similarity:73/191 - (38%) Gaps:33/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTL 122
            :.|.|...|:||...:.|.|:...:..:.|:|.        |....|::.:: |::.:|     |
  Fly   142 NAPENQYPTLGQDYVVMCEVKADPNPTIDWLRN--------GDPIRTTNDKY-VVQTNG-----L 192

  Fly   123 QIKYPQPRDSGVYECQINT-EPKMSLSYTFNV-VELKAEIFG-PSDLMVKTGSDINLTCKIMQGP 184
            .|:..|..|.|:|.|:... |....|..|..| |.::.||.. |::|....|......|.....|
  Fly   193 LIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKP 257

  Fly   185 HELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDW-TDGLTSRLKIKRAMPGDTGNYTCV 244
              :..|.|.:             |::...:...|.: .:..|..:.|......|.|.|||:
  Fly   258 --VPEISWIR-------------DATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 24/96 (25%)
IG_like 60..150 CDD:214653 22/90 (24%)
IG_like 163..257 CDD:214653 16/83 (19%)
Ig 174..244 CDD:143165 12/70 (17%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 24/95 (25%)
IGc2 152..209 CDD:197706 17/70 (24%)
I-set 230..319 CDD:254352 18/89 (20%)
IGc2 243..309 CDD:197706 14/76 (18%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.