DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:221 Identity:60/221 - (27%)
Similarity:91/221 - (41%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKY 126
            |::|.||:.....|.|..||...|.|::.....|........|.:.|..|...|.: .|.|.||.
  Fly    50 NVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQN-TWNLHIKA 113

  Fly   127 PQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFG---PSDLMVKTGSDINLTCKIMQGPHELG 188
            ....|.|.|.||:||:| |.....|..|.:..:...   .||::|..||.:.|||:....|..: 
  Fly   114 VSEEDRGGYMCQLNTDP-M
KSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPI- 176

  Fly   189 NIFWYK--GSEML--DGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV----- 244
             :.|.:  |:|::  |..|...:..|. |..|           ||:.:....:.|:|.|:     
  Fly   177 -VTWRREDGNEIVLKDNVGTKTLAPSF-RGEV-----------LKLSKISRNEMGSYLCIASNGV 228

  Fly   245 -PTVAKTSSVYVHVIIGEHPAAMQHN 269
             |:|:|..|:.:|.    ||.....|
  Fly   229 PPSVSKRISLSIHF----HPVIQVPN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/91 (32%)
IG_like 60..150 CDD:214653 28/87 (32%)
IG_like 163..257 CDD:214653 26/103 (25%)
Ig 174..244 CDD:143165 16/73 (22%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 25/79 (32%)
Ig 51..131 CDD:299845 26/81 (32%)
I-set 144..240 CDD:254352 26/109 (24%)
IGc2 159..228 CDD:197706 19/82 (23%)
Ig 244..337 CDD:299845 2/7 (29%)
I-set 244..337 CDD:254352 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.