| Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245505.1 | Gene: | kirre / 31292 | FlyBaseID: | FBgn0028369 | Length: | 956 | Species: | Drosophila melanogaster |
| Alignment Length: | 202 | Identity: | 48/202 - (23%) |
|---|---|---|---|
| Similarity: | 79/202 - (39%) | Gaps: | 39/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 PRNLTVTVGQTGFLHCRV-ERLGDKDVSWIR-------KRDLHILTAGGTTYTSDQRFQVLRPDG 116
Fly 117 SANWTLQIKYP-QPRDSGVYECQINTEPKMSLSYTFNVVEL------KAEIFGPSDLMVKT-GSD 173
Fly 174 INLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDT 238
Fly 239 GN--YTC 243 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 24/102 (24%) |
| IG_like | 60..150 | CDD:214653 | 24/98 (24%) | ||
| IG_like | 163..257 | CDD:214653 | 22/84 (26%) | ||
| Ig | 174..244 | CDD:143165 | 19/72 (26%) | ||
| kirre | NP_001245505.1 | Ig | 87..183 | CDD:299845 | 25/107 (23%) |
| IG_like | 88..182 | CDD:214653 | 25/106 (24%) | ||
| C2-set_2 | 189..279 | CDD:285423 | 22/88 (25%) | ||
| Ig_2 | 307..379 | CDD:290606 | |||
| I-set | 382..462 | CDD:254352 | |||
| IGc2 | 396..446 | CDD:197706 | |||
| Ig | 466..561 | CDD:299845 | |||
| IG_like | 478..561 | CDD:214653 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||