DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and rst

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:319 Identity:65/319 - (20%)
Similarity:110/319 - (34%) Gaps:95/319 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDFD------VPRNLTVTVGQTGFLHCRV-ERLGDKDVSWIR-------KRDLHILTAGGTTY 103
            ||..:.      .|::.|..||....|.||| .:.|  .:.|.:       .|||          
  Fly    21 PYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQG--TLQWTKDDFGLGTSRDL---------- 73

  Fly   104 TSDQRFQVLRPDGSANWTLQIKYPQPRDSGV-YECQINTEP--KMSLSYTFNVVELKAEIFGPSD 165
            :..:|:.::..|...:::|.| ||...|... |:||::..|  :.::..||..:.:......|  
  Fly    74 SGFERYAMVGSDEEGDYSLDI-YPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAP-- 135

  Fly   166 LMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKI 230
                         ||.|     |::.:  .:|  |.|.|.|..|...:...|..|.|||.:.|. 
  Fly   136 -------------KITQ-----GDVIY--ATE--DRKVEIECVSVGGKPAAEITWIDGLGNVLT- 177

  Fly   231 KRAMPGDTGNYTCVPT------VAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIV 289
                  |...||.:|.      .||:       ::...|....||::                 .
  Fly   178 ------DNIEYTVIPLPDQRRFTAKS-------VLRLTPKKEHHNTN-----------------F 212

  Fly   290 SCCLQHFYETGCGYLHAAAALAKSAGLGPPKRATLTTSETGISAAEVAAAAGASAAVAS 348
            ||..|:..:.    .:.:|.:.......|..:..:..|..|.:...|..|.|.|..:::
  Fly   213 SCQAQNTADR----TYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMST 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/105 (25%)
IG_like 60..150 CDD:214653 24/100 (24%)
IG_like 163..257 CDD:214653 23/99 (23%)
Ig 174..244 CDD:143165 19/69 (28%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 26/108 (24%)
Ig 42..114 CDD:299845 20/84 (24%)
C2-set_2 135..225 CDD:285423 29/148 (20%)
Ig_3 265..329 CDD:290638 0/3 (0%)
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.