DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:278 Identity:62/278 - (22%)
Similarity:96/278 - (34%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDF---------------DVPRNLTVTVGQTGF 72
            |..|:...::.|...|...|....:|..::.|..|               ..|.:.||..|....
  Rat     7 STCLMTCQSSLLPKKPRFLSQKMWAPHLVVAYLIFVTLALALPGTQTRFSQEPADQTVVAGHRAV 71

  Fly    73 LHCRVERLGDKDVSWIRKRDLHILTAG-GTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYE 136
            |.|.:..... .|.|.:..    |..| |....:..|::|:....:..:.|:|...:..|...||
  Rat    72 LPCVLLNYSG-IVQWTKDG----LALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYE 131

  Fly   137 CQINTEPKM---SLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYK---- 194
            ||. ||..:   ....|..:......|.|...::::.|:..||||:.... .....|.|::    
  Rat   132 CQA-TEAALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPYNLTCRAFNA-KPAATIIWFRDGTQ 194

  Fly   195 ------GSEML-DGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC------VPT 246
                  .:|:| |||.|..|  |...|:..|         |.|.|.       :||      :|.
  Rat   195 QEGAVTSTELLKDGKRETTI--SQLLIQPTD---------LDIGRV-------FTCRSMNEAIPN 241

  Fly   247 VAKTS-SVYVHVIIGEHP 263
            ..:|| .:.||     ||
  Rat   242 GKETSIELDVH-----HP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/98 (23%)
IG_like 60..150 CDD:214653 22/93 (24%)
IG_like 163..257 CDD:214653 26/111 (23%)
Ig 174..244 CDD:143165 21/86 (24%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 22/99 (22%)
Ig 57..148 CDD:299845 22/96 (23%)
Ig2_KIRREL3-like 170..251 CDD:143236 24/99 (24%)
I-set 255..336 CDD:254352 62/278 (22%)
Ig_2 259..337 CDD:290606
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.