DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and ncam1a

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:236 Identity:60/236 - (25%)
Similarity:79/236 - (33%) Gaps:63/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NLLP-----YFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRF 109
            |:||     |.:.    |.|..:.|...|.|..:...:..|.|.|         |.|...||:::
Zfish   206 NVLPSIRTRYTEL----NATADINQAVTLACHADGYPEPTVKWAR---------GNTELESDEKY 257

  Fly   110 QVLRPDGSANWTLQIKYPQPRDSGVYEC-QINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSD 173
            . |..|||   .|.||.....|.|.|:| ..|...:.|...|.||.......|..:....:....
Zfish   258 S-LNEDGS---ELTIKDVNKLDEGDYKCIARNKAGERSEEVTLNVFVQPKITFLENQTASELEEQ 318

  Fly   174 INLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWT----------------D 222
            |.|||:....|  ..||.|..|..:..   |||          :..||                |
Zfish   319 ITLTCEATGDP--TPNIIWSFGRRVFT---ENE----------QASWTRPEKHKSLDGNVVVRSD 368

  Fly   223 GLTSRLKIKRAMPGDTGNYTCVPTVAKTS------SVYVHV 257
            ...|.|.:|.....|.|.|.|   .|:.|      |:|:.|
Zfish   369 ARVSSLTLKYVQFTDAGQYLC---TARNSIGQDIQSMYLEV 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 27/95 (28%)
IG_like 60..150 CDD:214653 25/90 (28%)
IG_like 163..257 CDD:214653 26/115 (23%)
Ig 174..244 CDD:143165 21/85 (25%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653
IGc2 128..189 CDD:197706
Ig 208..301 CDD:299845 31/109 (28%)
IG_like 219..298 CDD:214653 26/91 (29%)
Ig 300..406 CDD:299845 27/123 (22%)
IG_like 308..406 CDD:214653 26/115 (23%)
ig 413..498 CDD:278476
IG_like 415..498 CDD:214653
fn3 505..589 CDD:278470
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.