DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Lsamp

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:339 Identity:79/339 - (23%)
Similarity:130/339 - (38%) Gaps:98/339 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLIGWLL-LLSMVLLRGYNAALAPTPPTTSTTTISPSNL--LPYFDFDVPR---NLTVTVGQTGF 72
            |::|:.| |.|:.:|..:|     .||  :...:||..:  ||....|..|   |:||..|.|..
  Rat    10 WVLGFFLSLFSLQVLAFWN-----QPP--AEVNLSPITIPGLPVRSVDFNRGTDNITVRQGDTAI 67

  Fly    73 LHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYEC 137
            |.|.||....| |:|:.:..  |:.||...::.|.|.: |....:..::|:|:.....|.|.|.|
  Rat    68 LRCVVEDKNSK-VAWLNRSG--IIFAGHDKWSLDPRVE-LEKRHALEYSLRIQKVDVYDEGSYTC 128

  Fly   138 QINTEPKMSLSYTFNVVELKAEIFG-PSDLMVKTGSDINLTCKIMQGPHELGNIFW--------- 192
            .:.|:.:...|..:.:|::..:|.. .||:.|..||::.|.|.....|..:  |.|         
  Rat   129 SVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPV--ITWRHLTPLGRE 191

  Fly   193 YKGSE--------------MLDGKGENEIDSS-MARIRV------------EDDWTDGLTSRLKI 230
            ::|.|              ..:.|..||:.|: :.:::|            .::.|.|..:.||.
  Rat   192 FEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKC 256

  Fly   231 K-RAMPG--------DT-----------------------------GNYTCVPT----VAKTSSV 253
            : .|:|.        ||                             ||||||..    |...|.|
  Rat   257 EASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLV 321

  Fly   254 YVHVIIGEHPAAMQ 267
            ....::...|..:|
  Rat   322 LFKRVLPTVPHPIQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 27/97 (28%)
IG_like 60..150 CDD:214653 27/92 (29%)
IG_like 163..257 CDD:214653 34/171 (20%)
Ig 174..244 CDD:143165 24/143 (17%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 26/93 (28%)
FR1 55..71 CDD:409353 6/15 (40%)
Ig strand A' 56..62 CDD:409353 3/5 (60%)
Ig strand B 64..72 CDD:409353 3/7 (43%)
CDR1 72..76 CDD:409353 2/3 (67%)
FR2 77..84 CDD:409353 3/7 (43%)
Ig strand C 77..83 CDD:409353 3/6 (50%)
CDR2 85..95 CDD:409353 3/11 (27%)
Ig strand C' 87..90 CDD:409353 1/2 (50%)
Ig strand C' 92..95 CDD:409353 0/2 (0%)
FR3 96..131 CDD:409353 9/35 (26%)
Ig strand D 100..107 CDD:409353 2/7 (29%)
Ig strand E 110..116 CDD:409353 1/5 (20%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 1/8 (13%)
FR4 138..145 CDD:409353 1/6 (17%)
Ig_3 148..218 CDD:404760 14/71 (20%)
Ig strand A' 155..160 CDD:409353 2/4 (50%)
Ig strand B 166..173 CDD:409353 2/6 (33%)
Ig strand C 179..184 CDD:409353 2/6 (33%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 0/5 (0%)
Ig strand F 210..217 CDD:409353 1/6 (17%)
Ig strand G 224..232 CDD:409353 1/7 (14%)
Ig_3 235..311 CDD:404760 14/75 (19%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 0/3 (0%)
Ig strand F 304..309 CDD:409353 4/4 (100%)
Ig strand G 318..321 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.