DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr7

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:284 Identity:118/284 - (41%)
Similarity:165/284 - (58%) Gaps:37/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TSTTTISPSNLL----PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGT 101
            ::|:.:|.::|.    |:||...|||::..|.:...|.|||:..|::.|||:|||||||||....
  Fly    35 SATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIY 99

  Fly   102 TYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVV------ELK--- 157
            |||.||||.|:.|.||.:|.|:|.|.|||||||||||:|||||::|:....|:      :||   
  Fly   100 TYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKK 164

  Fly   158 ---------AEIFGPSDLMVKTGSDINLTCKI-MQGPHELGNIFWYKGSEMLDGKGENEIDSSMA 212
                     |:|.|.:::.||..|.|.|.|.: :..|    ::.||.||.::|      .||...
  Fly   165 RFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAP----SVIWYHGSSVVD------FDSLRG 219

  Fly   213 RIRVEDDWTD-GLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNS 276
            .|.:|.:.|| |.||||.:.||...|:|||||||..|..:||.|||:.||.|||||.:|:....:
  Fly   220 GISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRA 284

  Fly   277 FYCGICCM---LLSIVSCCLQHFY 297
            |...|..:   :|..:|..::|.|
  Fly   285 FTAMITIISTKVLLYISSLMEHMY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 53/94 (56%)
IG_like 60..150 CDD:214653 53/89 (60%)
IG_like 163..257 CDD:214653 37/95 (39%)
Ig 174..244 CDD:143165 27/71 (38%)
dpr7NP_001096850.2 V-set 56..145 CDD:284989 52/88 (59%)
IG_like 58..140 CDD:214653 48/81 (59%)
IG_like 179..265 CDD:214653 37/95 (39%)
Ig 187..257 CDD:299845 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.