DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr9

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:290 Identity:115/290 - (39%)
Similarity:153/290 - (52%) Gaps:28/290 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDK----DVSWIRKRDLHILTAGGTTYTSDQRFQ 110
            |..||||....:|:|..:|:|.:|:|||:.||:|    .|||:|.||:|:||.|..||||||||:
  Fly   253 NAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFR 317

  Fly   111 VLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDIN 175
            .:....:.:|.|||||||.||||:||||::|.|.||.....||||...||.|..||.:::||.||
  Fly   318 AIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDLYIESGSTIN 382

  Fly   176 LTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGN 240
            |||.|...|.....|||...:...........||....:.|..:..|..||.|.||.|.|.|:|:
  Fly   383 LTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGH 447

  Fly   241 YTCVPTVAKTSSVYVHVIIG-EHPA--------AMQHNSSSNSNSFYCGIC---CMLLSIVSCCL 293
            |.|.|:.||..||.|||:.| .|..        |.:..|:|:..:....:|   |:||.:.:|  
  Fly   448 YQCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSVCVPVCVLLQLGAC-- 510

  Fly   294 QHFYETGCGYLHAAAALAKSAGLGPPKRAT 323
                      ...||.|..:....||.|:|
  Fly   511 ----------RWIAALLGAALATPPPLRST 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 50/98 (51%)
IG_like 60..150 CDD:214653 49/93 (53%)
IG_like 163..257 CDD:214653 35/93 (38%)
Ig 174..244 CDD:143165 24/69 (35%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 50/97 (52%)
IG_like 263..360 CDD:214653 49/96 (51%)
IG_like 371..464 CDD:214653 35/92 (38%)
IGc2 377..456 CDD:197706 28/78 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.