Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276009.1 | Gene: | CNTN6 / 27255 | HGNCID: | 2176 | Length: | 1028 | Species: | Homo sapiens |
Alignment Length: | 219 | Identity: | 53/219 - (24%) |
---|---|---|---|
Similarity: | 78/219 - (35%) | Gaps: | 73/219 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 SWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYT 150
Fly 151 FNVVELKAEI--------FGPSDL----MVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKG 203
Fly 204 ENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT----VAK-TSSVYV-------- 255
Fly 256 -----HVIIGEH---PAAMQHNSS 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 14/67 (21%) |
IG_like | 60..150 | CDD:214653 | 14/63 (22%) | ||
IG_like | 163..257 | CDD:214653 | 30/115 (26%) | ||
Ig | 174..244 | CDD:143165 | 19/69 (28%) | ||
CNTN6 | NP_001276009.1 | Ig | 26..118 | CDD:325142 | |
Ig | 120..214 | CDD:325142 | |||
Ig | 227..315 | CDD:325142 | |||
Ig | 319..403 | CDD:325142 | 16/75 (21%) | ||
Ig | 424..496 | CDD:325142 | 27/88 (31%) | ||
Ig | 515..598 | CDD:325142 | 4/14 (29%) | ||
FN3 | 598..691 | CDD:238020 | |||
FN3 | 703..796 | CDD:238020 | |||
FN3 | 805..898 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 887..908 | ||||
FN3 | 906..991 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |