DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and CNTN6

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001276009.1 Gene:CNTN6 / 27255 HGNCID:2176 Length:1028 Species:Homo sapiens


Alignment Length:219 Identity:53/219 - (24%)
Similarity:78/219 - (35%) Gaps:73/219 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYT 150
            :|::         .|.....::|.|:      .|.||.|......|||||:|....:        
Human   350 TWLK---------NGERLNPEERIQI------ENGTLIITMLNVSDSGVYQCAAENK-------- 391

  Fly   151 FNVVELKAEI--------FGPSDL----MVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKG 203
            :.::...||:        |..|.:    .|:.|.||.:.||....|.  ..|.|.:|:|.|    
Human   392 YQIIYANAELRV
LASAPDFSKSPVKKKSFVQVGGDIVIGCKPNAFPR--AAISWKRGTETL---- 450

  Fly   204 ENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT----VAK-TSSVYV-------- 255
                 ....||.:.:|      ..|||......|.|:|||:.|    .|| |.|:.|        
Human   451 -----RQSKRIFLLED------GSLKIYNITRSDAGSYTCIATNQFGTAKNTGSLIVKERTVITV 504

  Fly   256 -----HVIIGEH---PAAMQHNSS 271
                 .|.:||.   |..:.|:.|
Human   505 PPSKMDVTVGESIVLPCQVSHDPS 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 14/67 (21%)
IG_like 60..150 CDD:214653 14/63 (22%)
IG_like 163..257 CDD:214653 30/115 (26%)
Ig 174..244 CDD:143165 19/69 (28%)
CNTN6NP_001276009.1 Ig 26..118 CDD:325142
Ig 120..214 CDD:325142
Ig 227..315 CDD:325142
Ig 319..403 CDD:325142 16/75 (21%)
Ig 424..496 CDD:325142 27/88 (31%)
Ig 515..598 CDD:325142 4/14 (29%)
FN3 598..691 CDD:238020
FN3 703..796 CDD:238020
FN3 805..898 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908
FN3 906..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.