DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Jaml

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_006510445.4 Gene:Jaml / 270152 MGIID:2685484 Length:405 Species:Mus musculus


Alignment Length:380 Identity:88/380 - (23%)
Similarity:132/380 - (34%) Gaps:99/380 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GWLLLLSMVLLR--GYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVER 79
            |.|..|..|:|.  ||...|      ...|..||             .|.|.||::..:.|.|:|
Mouse    30 GGLFFLGTVILAPVGYPQGL------PGLTVSSP-------------QLRVHVGESVLMGCVVQR 75

  Fly    80 LGDKD---VSWIRKRDL-----HILTAGGTTYTSDQRFQ--------VLRPDGSANWTLQIKYPQ 128
            ..:|.   |.|:..:|.     ::|...........|||        ....|||    |.::..|
Mouse    76 TEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGS----LLLQDVQ 136

  Fly   129 PRDSGVYECQINTEPKMSLSYTFNVVELKAEIF----GPSDLMVKTGSDINLTCKIM-------- 181
            ..|.|:|.|:|.      |.....|::...|::    .|.||.|:.|....:.|.|.        
Mouse   137 KADEGIYTCEIR------LKNESMVMKKPVELWVLPEEPKDLRVRVGDTTQMRCSIQSTEEKRVT 195

  Fly   182 -------QGPH-ELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLT---SRLKIKRAMP 235
                   .|.| |...:..| .|.|..||.:     |:.|.|...|.|..::   ..:|::....
Mouse   196 KVNWMFSSGSHTEEETVLSY-DSNMRSGKFQ-----SLGRFRNRVDLTGDISRNDGSIKLQTVKE 254

  Fly   236 GDTGNYTCVPTVAKTSS---VYVHVIIGEH--------PAAMQHNSSSNSNS--FYCGICC---M 284
            .|.|.|||...|.|..|   :.:||:..|.        |.........|.|.  ...||.|   :
Mouse   255 SDQGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGNQLVIIVGIVCATFL 319

  Fly   285 LLSIVSCCLQ--HFYETGCGYLHAAAALAKSAGLGPPKR-----ATLTTSETGIS 332
            ||.::...::  .:.::....:.:..:|.....:.|.|.     .|..|:|.|||
Mouse   320 LLPVLILIVKKAKWNKSSVSSMASVKSLENKEKINPEKHIYSSITTWETTERGIS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/110 (24%)
IG_like 60..150 CDD:214653 26/105 (25%)
IG_like 163..257 CDD:214653 29/115 (25%)
Ig 174..244 CDD:143165 20/88 (23%)
JamlXP_006510445.4 V-set 55..165 CDD:369466 30/132 (23%)
V-set 167..280 CDD:369466 30/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.