DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and NEGR1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:380 Identity:80/380 - (21%)
Similarity:135/380 - (35%) Gaps:103/380 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVP----RNLTVTVGQTGFLH 74
            ||...||.|..:|                     ||.|......|.|    .|:.|..|.|..|.
Human    16 WLAAVLLSLCCLL---------------------PSCLPAGQSVDFPWAAVDNMMVRKGDTAVLR 59

  Fly    75 CRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQI 139
            |.:|. |....:|:.:..  |:.|||..::.|.|..:...: ..:::|||:.....|.|.|.|.:
Human    60 CYLED-GASKGAWLNRSS--IIFAGGDKWSVDPRVSISTLN-KRDYSLQIQNVDVTDDGPYTCSV 120

  Fly   140 NTEPKMSLSYTFNVVELKAEIFGPS-DLMVKTGSDINLTCKIMQGPHELGNIFW---------YK 194
            .|:...........|::..:|:..| |:.|..|:::.|||.....|..  :|.|         ::
Human   121 QTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEP--SISWRHISPSAKPFE 183

  Fly   195 GSEMLDGKG-------------ENEID-SSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC-- 243
            ..:.||..|             ||::. ..:.:::|..::...: ..:|.....||.:|...|  
Human   184 NGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTI-QEIKSGTVTPGRSGLIRCEG 247

  Fly   244 --VPTVA--------KTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFYE 298
              ||..|        |..:....:||        .|.|:.|          :|::.:...:||..
Human   248 AGVPPPAFEWYKGEKKLFNGQQGIII--------QNFSTRS----------ILTVTNVTQEHFGN 294

  Fly   299 TGCGYLHAAAALAKSAGLGPPKRATLTTSETGISAAEVAAAAGASAAVASALATC 353
            ..|...:.......|..|.||     :|::.||:.:            |..|.:|
Human   295 YTCVAANKLGTTNASLPLNPP-----STAQYGITGS------------ADVLFSC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 24/98 (24%)
IG_like 60..150 CDD:214653 24/93 (26%)
IG_like 163..257 CDD:214653 25/129 (19%)
Ig 174..244 CDD:143165 17/96 (18%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 23/91 (25%)
IGc2 152..210 CDD:197706 12/59 (20%)
Ig_3 225..301 CDD:372822 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.