DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Bsg

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001103352.1 Gene:Bsg / 25246 RGDID:2220 Length:388 Species:Rattus norvegicus


Alignment Length:223 Identity:50/223 - (22%)
Similarity:75/223 - (33%) Gaps:52/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TGFLHCRVERLGDKD-------VSWIRKRDLHILTAGGTTYTS----DQRFQV---LRPDG---- 116
            ||...||.....|::       |.|:|.:...::...||..||    |.:.|:   |...|    
  Rat   103 TGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIVTSVQEVDSKTQLTCFLNSSGIDIV 167

  Fly   117 SANW-------------TLQIKYPQPRD--SGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDL 166
            ...|             .||:||....|  ||.|.|....||         |......:.||..:
  Rat   168 GHRWMRGGKVLQEDTLPDLQMKYTVDADDRSGEYSC
IFLPEP---------VGRGNINVEGPPRI 223

  Fly   167 MV-------KTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGL 224
            .|       ..|..:.|.||.......:....|:|.|:..|....|..:::...:.:.   |..|
  Rat   224 KVGKKSEHASEGEFVKLICKSEASHPPVDEWVWFKTSDTGDQTISNGTEANSKYVIIS---TPEL 285

  Fly   225 TSRLKIKRAMPGDTGNYTCVPTVAKTSS 252
            :..:.....|..|.|.|.|..|.::.|:
  Rat   286 SELIISDLDMNVDPGTYVCNATNSQGSA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 28/116 (24%)
IG_like 60..150 CDD:214653 28/112 (25%)
IG_like 163..257 CDD:214653 20/97 (21%)
Ig 174..244 CDD:143165 14/69 (20%)
BsgNP_001103352.1 IG_like 29..113 CDD:214653 4/9 (44%)
Ig 40..111 CDD:143165 4/7 (57%)
Ig 139..203 CDD:299845 17/63 (27%)
IG_like 228..321 CDD:214653 18/89 (20%)
Ig 238..318 CDD:143165 17/79 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.