DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Pvr

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_058772.2 Gene:Pvr / 25066 RGDID:3813 Length:412 Species:Rattus norvegicus


Alignment Length:269 Identity:67/269 - (24%)
Similarity:96/269 - (35%) Gaps:78/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRANIGLLNWLIGW--LLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTV 67
            ||:.:    |.:|.  |||||...|:.....:|                     ..|..|.|..:
  Rat     8 SRSRV----WSVGLLRLLLLSCFTLQKAGGEIA---------------------VQVLSNSTGFL 47

  Fly    68 GQTGFLHCRVERLGDKD------VSWIRKRD---LHILTA-----GGTTYTSDQRFQVLRP---D 115
            |.:..|||   .|..||      ::|: |||   .|...|     .|.:.:..:|.:.|..   :
  Rat    48 GGSTVLHC---SLASKDNVTITQLTWM-KRDPDGSHPSVAVFHPKKGPSISDPERVKFLVAKVYE 108

  Fly   116 GSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELK--------AEIFGPSDLMVKTGS 172
            ...|.:|.|...:..|.|:|||||.|.|..|.|..   |.||        ||...||..::.  .
  Rat   109 DLRNASLAISNLRVEDEGIYECQIATFPTGSKSAN---VWLKVFARPKNTAEALEPSPTLMP--Q 168

  Fly   173 DINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMP-- 235
            |: ..|....| |..|.|.|           .:.::.|...:: |.....|.|:.:.....:|  
  Rat   169 DV-AKCISADG-HPPGRITW-----------SSNVNGSYREMK-ETGSQPGTTTVISYLSMVPSS 219

  Fly   236 -GDTGNYTC 243
             .|..|.||
  Rat   220 QADGTNITC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 33/111 (30%)
IG_like 60..150 CDD:214653 32/106 (30%)
IG_like 163..257 CDD:214653 18/84 (21%)
Ig 174..244 CDD:143165 15/73 (21%)
PvrNP_058772.2 IG_like 41..148 CDD:214653 34/113 (30%)
Ig1_PVR_like 49..148 CDD:143195 31/105 (30%)
Ig 152..246 CDD:299845 20/93 (22%)
IG_like 268..338 CDD:214653
Ig <269..342 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.