Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038936733.1 | Gene: | Ncam1 / 24586 | RGDID: | 67378 | Length: | 1136 | Species: | Rattus norvegicus |
Alignment Length: | 227 | Identity: | 53/227 - (23%) |
---|---|---|---|
Similarity: | 86/227 - (37%) | Gaps: | 35/227 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 VPRNLTVTVGQTGFLHCRVE-RLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTL 122
Fly 123 QIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIF--GPSDLMVKTGSDINLTCKIMQG-- 183
Fly 184 PHELGNIFW-YKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTV 247
Fly 248 AKTSSVY---VHVIIGEHPAAMQHNSSSNSNS 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 27/95 (28%) |
IG_like | 60..150 | CDD:214653 | 24/90 (27%) | ||
IG_like | 163..257 | CDD:214653 | 19/99 (19%) | ||
Ig | 174..244 | CDD:143165 | 14/72 (19%) | ||
Ncam1 | XP_038936733.1 | IgI_1_NCAM-1 | 20..116 | CDD:409451 | 28/98 (29%) |
Ig strand B | 37..41 | CDD:409451 | 1/3 (33%) | ||
Ig strand C | 51..55 | CDD:409451 | 2/3 (67%) | ||
Ig strand E | 79..83 | CDD:409451 | 2/4 (50%) | ||
Ig strand F | 93..98 | CDD:409451 | 2/4 (50%) | ||
Ig strand G | 107..110 | CDD:409451 | 0/2 (0%) | ||
IG_like | 124..190 | CDD:214653 | 18/83 (22%) | ||
Ig strand B | 135..139 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 148..152 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 172..176 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 186..191 | CDD:409353 | 2/4 (50%) | ||
IgI_3_NCAM-1 | 211..308 | CDD:143207 | 3/15 (20%) | ||
Ig strand B | 231..235 | CDD:143207 | |||
Ig strand C | 244..248 | CDD:143207 | |||
Ig strand E | 271..275 | CDD:143207 | |||
Ig strand F | 285..290 | CDD:143207 | |||
Ig strand G | 298..301 | CDD:143207 | |||
IgI_NCAM-1 | 307..413 | CDD:143277 | |||
Ig strand B | 326..330 | CDD:143277 | |||
Ig strand C | 339..343 | CDD:143277 | |||
Ig strand E | 379..383 | CDD:143277 | |||
Ig strand F | 393..398 | CDD:143277 | |||
Ig strand G | 406..409 | CDD:143277 | |||
Ig_3 | 422..494 | CDD:404760 | |||
Ig strand B | 433..437 | CDD:409353 | |||
Ig strand C | 446..450 | CDD:409353 | |||
Ig strand E | 473..477 | CDD:409353 | |||
Ig strand F | 487..492 | CDD:409353 | |||
FN3 | 509..606 | CDD:238020 | |||
fn3 | 619..701 | CDD:394996 | |||
Herpes_BLLF1 | <842..1133 | CDD:282904 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |