DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Ncam1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_038936733.1 Gene:Ncam1 / 24586 RGDID:67378 Length:1136 Species:Rattus norvegicus


Alignment Length:227 Identity:53/227 - (23%)
Similarity:86/227 - (37%) Gaps:35/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VPRNLTVTVGQTGFLHCRVE-RLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTL 122
            ||....::||::.|..|:|. ...|||:||....       |.....:.||..|:..|..:: ||
  Rat    25 VPSQGEISVGESKFFLCQVAGDAKDKDISWFSPN-------GEKLSPNQQRISVVWNDDDSS-TL 81

  Fly   123 QIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIF--GPSDLMVKTGSDINLTCKIMQG-- 183
            .|......|:|:|:|.:..|.......|.||...:..:|  .|:....|.|.|..:.|.::..  
  Rat    82 TIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLP 146

  Fly   184 PHELGNIFW-YKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTV 247
            |    .|.| :||.:::..|....|..|              .:.|:|:.....|.|.|.|...:
  Rat   147 P----TIIWKHKGRDVILKKDVRFIVLS--------------NNYLQIRGIKKTDEGTYRCEGRI 193

  Fly   248 AKTSSVY---VHVIIGEHPAAMQHNSSSNSNS 276
            .....:.   :.||:...|......|..|:.:
  Rat   194 LARGEINFKDIQVIVNVPPTVQARQSIVNATA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 27/95 (28%)
IG_like 60..150 CDD:214653 24/90 (27%)
IG_like 163..257 CDD:214653 19/99 (19%)
Ig 174..244 CDD:143165 14/72 (19%)
Ncam1XP_038936733.1 IgI_1_NCAM-1 20..116 CDD:409451 28/98 (29%)
Ig strand B 37..41 CDD:409451 1/3 (33%)
Ig strand C 51..55 CDD:409451 2/3 (67%)
Ig strand E 79..83 CDD:409451 2/4 (50%)
Ig strand F 93..98 CDD:409451 2/4 (50%)
Ig strand G 107..110 CDD:409451 0/2 (0%)
IG_like 124..190 CDD:214653 18/83 (22%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
IgI_3_NCAM-1 211..308 CDD:143207 3/15 (20%)
Ig strand B 231..235 CDD:143207
Ig strand C 244..248 CDD:143207
Ig strand E 271..275 CDD:143207
Ig strand F 285..290 CDD:143207
Ig strand G 298..301 CDD:143207
IgI_NCAM-1 307..413 CDD:143277
Ig strand B 326..330 CDD:143277
Ig strand C 339..343 CDD:143277
Ig strand E 379..383 CDD:143277
Ig strand F 393..398 CDD:143277
Ig strand G 406..409 CDD:143277
Ig_3 422..494 CDD:404760
Ig strand B 433..437 CDD:409353
Ig strand C 446..450 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
FN3 509..606 CDD:238020
fn3 619..701 CDD:394996
Herpes_BLLF1 <842..1133 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.