DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Lrit3

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001274153.1 Gene:Lrit3 / 242235 MGIID:2685267 Length:681 Species:Mus musculus


Alignment Length:397 Identity:79/397 - (19%)
Similarity:120/397 - (30%) Gaps:149/397 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WLLLLSMVLLRG---YNAALAPTP---------------PTTSTTTISPSNLLPYFDF-DVPRNL 63
            |:.||.|..||.   :|..:|..|               .:...||:.|       || |...:|
Mouse   122 WVSLLDMPHLRTLDLHNNRIASVPNEAVRYLRNLTCLDLSSNRLTTLPP-------DFLDSWSHL 179

  Fly    64 TVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQ 128
            .||..::.....|...||.:|..|.  .|.||......:..:|....:|.|              
Mouse   180 AVTPSRSPDFPPRRIILGLQDNPWF--CDCHISKVIELSKVTDHAVVLLDP-------------- 228

  Fly   129 PRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKT------GSDINLTCKIMQGPHEL 187
                    ..:.:||:......|..|||: :...||.:|..|      ||::.|.|         
Mouse   229 --------LMVCSEPERFQGILFQRVELE-KCLKPSVMMSATKITSALGSNVLLRC--------- 275

  Fly   188 GNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPG---------------- 236
                        |.||......:..|       :||.|....:.:..||                
Mouse   276 ------------DAKGHPTPQLTWTR-------SDGSTVNYTVIQESPGEGIRWSIISLTSISHK 321

  Fly   237 DTGNYTC-VPTVAKTSSVYVHV-IIG--------------------EHPAAMQHNSSSNSNSFYC 279
            |.|:|.| ...:|..|...|.| ::|                    :||......|:..|.|:  
Mouse   322 DAGDYRCKAKNLAGISEAVVTVTVVGGVTTTLSPDSSERSPGEPPEQHPQPGLGGSTPPSKSW-- 384

  Fly   280 GICCMLLSIVSCCLQHFYETGCGYLHAAAALAKSAGLGPPKRATLTTSETGISAAEVAAAAGASA 344
                         |.....:...|...:|||..|....||.           |...:.:||.|:.
Mouse   385 -------------LSPGLTSAPSYPTPSAALYTSTWSPPPS-----------SLPPIFSAASATT 425

  Fly   345 AVASALA 351
            :|.::::
Mouse   426 SVQTSIS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 17/94 (18%)
IG_like 60..150 CDD:214653 16/89 (18%)
IG_like 163..257 CDD:214653 24/116 (21%)
Ig 174..244 CDD:143165 15/86 (17%)
Lrit3NP_001274153.1 LRR 1. /evidence=ECO:0000255 56..79
LRR_8 61..117 CDD:290566
LRR 2. /evidence=ECO:0000255 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3. /evidence=ECO:0000255 104..128 3/5 (60%)
LRR_8 105..165 CDD:290566 9/42 (21%)
LRR_4 106..146 CDD:289563 8/23 (35%)
leucine-rich repeat 107..130 CDD:275378 4/7 (57%)
LRR_4 129..170 CDD:289563 7/40 (18%)
LRR 4. /evidence=ECO:0000255 129..151 5/21 (24%)
leucine-rich repeat 131..154 CDD:275378 5/22 (23%)
LRR 5. /evidence=ECO:0000255 152..175 5/29 (17%)
leucine-rich repeat 155..168 CDD:275378 1/12 (8%)
Ig 254..335 CDD:299845 21/108 (19%)
IG_like 263..339 CDD:214653 19/103 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..391 6/55 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..464 1/8 (13%)
FN3 489..563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.