| Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_766388.2 | Gene: | Sdk2 / 237979 | MGIID: | 2443847 | Length: | 2176 | Species: | Mus musculus |
| Alignment Length: | 329 | Identity: | 66/329 - (20%) |
|---|---|---|---|
| Similarity: | 107/329 - (32%) | Gaps: | 106/329 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 LLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRK 90
Fly 91 RDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYEC-QINTEPKMSLSYTFNVV 154
Fly 155 ELKAEIF-GPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEML------------------- 199
Fly 200 -----------------DGKGENEIDSSMA--------------------------------RIR 215
Fly 216 VEDDW-TDGLT--------------SRLKIKRAMPGDTGNYTC-VPTVAKTSSVYVHVIIGEHPA 264
Fly 265 AMQH 268 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 22/95 (23%) |
| IG_like | 60..150 | CDD:214653 | 22/90 (24%) | ||
| IG_like | 163..257 | CDD:214653 | 30/177 (17%) | ||
| Ig | 174..244 | CDD:143165 | 24/153 (16%) | ||
| Sdk2 | NP_766388.2 | IG_like | 44..113 | CDD:214653 | |
| IGc2 | 44..102 | CDD:197706 | |||
| IG_like | 124..207 | CDD:214653 | |||
| Ig | 136..192 | CDD:299845 | |||
| IG_like | 226..308 | CDD:214653 | 4/18 (22%) | ||
| IGc2 | 237..290 | CDD:197706 | |||
| I-set | 312..401 | CDD:254352 | 24/100 (24%) | ||
| Ig | 330..398 | CDD:143165 | 20/79 (25%) | ||
| I-set | 406..496 | CDD:254352 | 16/91 (18%) | ||
| Ig | 420..496 | CDD:299845 | 11/77 (14%) | ||
| Ig | 506..590 | CDD:299845 | 17/83 (20%) | ||
| IG_like | 506..590 | CDD:214653 | 17/83 (20%) | ||
| FN3 | 594..685 | CDD:238020 | 3/6 (50%) | ||
| FN3 | 697..790 | CDD:238020 | |||
| FN3 | 798..894 | CDD:238020 | |||
| FN3 | 899..987 | CDD:238020 | |||
| FN3 | 997..1091 | CDD:238020 | |||
| FN3 | 1103..1198 | CDD:238020 | |||
| FN3 | 1205..1294 | CDD:238020 | |||
| FN3 | 1305..1398 | CDD:238020 | |||
| FN3 | 1404..1488 | CDD:238020 | |||
| FN3 | 1507..1620 | CDD:238020 | |||
| FN3 | 1630..1723 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1712..1734 | ||||
| FN3 | 1728..1809 | CDD:238020 | |||
| FN3 | 1841..1920 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2013..2032 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2043..2070 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2102..2176 | ||||
| PDZ-binding. /evidence=ECO:0000269|PubMed:20219992 | 2170..2176 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||