DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:222 Identity:55/222 - (24%)
Similarity:91/222 - (40%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRP 114
            |..|.|....|:.:....|.:..:.|.........|:|:::         ||...:..::||  .
Mouse   138 NAPPTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKE---------GTLLGASAKYQV--S 191

  Fly   115 DGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFG-PSDLMVKTGSDINLTC 178
            |||    |.:......|.|.|.|:..:....::..|..:|:....|.. |.::.|....|..|||
Mouse   192 DGS----LTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTC 252

  Fly   179 KIMQGPHELGNI--FWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNY 241
            :....|   ||:  .||...|.:..:.:.::     |:|:..|.|      |.|.|..|.|.|.|
Mouse   253 RAEAYP---GNLTYTWYWQDENVYFQNDLKL-----RVRILIDGT------LIIFRVKPEDAGKY 303

  Fly   242 TCVPT----VAKTSSVYVHVIIGEHPA 264
            ||||:    .:.::|.|:.|   ::||
Mouse   304 TCVPSNSLGRSPSASAYLTV---QYPA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 18/94 (19%)
IG_like 60..150 CDD:214653 17/89 (19%)
IG_like 163..257 CDD:214653 29/99 (29%)
Ig 174..244 CDD:143165 21/71 (30%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462 20/100 (20%)
Ig 231..323 CDD:386229 30/105 (29%)
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.