| Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011509159.1 | Gene: | OBSL1 / 23363 | HGNCID: | 29092 | Length: | 1918 | Species: | Homo sapiens |
| Alignment Length: | 222 | Identity: | 57/222 - (25%) |
|---|---|---|---|
| Similarity: | 81/222 - (36%) | Gaps: | 50/222 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 YNAALAPTPPT---TSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKR 91
Fly 92 DLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEP-KMSLSYTFNVVE 155
Fly 156 LKAEIFGPSDLMVKT----GSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRV 216
Fly 217 EDDWTDGLTSRLKIKRAMPGDTGNYTC 243 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 24/95 (25%) |
| IG_like | 60..150 | CDD:214653 | 23/90 (26%) | ||
| IG_like | 163..257 | CDD:214653 | 22/85 (26%) | ||
| Ig | 174..244 | CDD:143165 | 19/70 (27%) | ||
| OBSL1 | XP_011509159.1 | IG_like | 18..101 | CDD:214653 | |
| IGc2 | 25..88 | CDD:197706 | |||
| IG | 134..226 | CDD:214652 | |||
| IGc2 | 142..216 | CDD:197706 | |||
| IG | 252..336 | CDD:214652 | |||
| Ig | 252..336 | CDD:299845 | |||
| I-set | 342..426 | CDD:254352 | |||
| Ig | 358..421 | CDD:143165 | |||
| IG_like | 435..510 | CDD:214653 | |||
| FN3 | 518..602 | CDD:238020 | |||
| IG | 725..802 | CDD:214652 | |||
| Ig | 734..802 | CDD:143165 | |||
| Ig | 825..893 | CDD:143165 | |||
| Ig | 916..984 | CDD:143165 | |||
| IG | 1005..1074 | CDD:214652 | |||
| Ig | 1007..1075 | CDD:143165 | |||
| IG_like | 1097..1154 | CDD:214653 | |||
| IGc2 | 1099..1159 | CDD:197706 | |||
| Ig_Semaphorin_C | 1178..1267 | CDD:143180 | 30/114 (26%) | ||
| IG | 1180..1262 | CDD:214652 | 26/107 (24%) | ||
| IG | 1282..1343 | CDD:214652 | 21/75 (28%) | ||
| IGc2 | 1283..1341 | CDD:197706 | 20/72 (28%) | ||
| I-set | 1361..1444 | CDD:254352 | |||
| ig | 1364..1430 | CDD:278476 | |||
| IG_like | 1456..1535 | CDD:214653 | |||
| Ig | 1481..1536 | CDD:143165 | |||
| I-set | 1541..1624 | CDD:254352 | |||
| I-set | 1631..1714 | CDD:254352 | |||
| Ig | 1635..1724 | CDD:299845 | |||
| I-set | 1725..1803 | CDD:254352 | |||
| Ig | 1814..1893 | CDD:299845 | |||
| IG_like | 1815..1893 | CDD:214653 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||