DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Ttn

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001372637.1 Gene:Ttn / 22138 MGIID:98864 Length:35463 Species:Mus musculus


Alignment Length:230 Identity:58/230 - (25%)
Similarity:93/230 - (40%) Gaps:42/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVL- 112
            |.|.|....:.|.::.||.|.|..|.|.|....:....|.:         .|...|||.::::. 
Mouse  8594 SVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFK---------DGKELTSDNKYKISF 8649

  Fly   113 --RPDGSANWTLQIKYPQPRDSGVYECQI-NTEPKMSLSYTFNVVELKAEIFGPS------DLMV 168
              :..|     |:|....|.|||||..:: |...|.|...:   :::...|..||      :...
Mouse  8650 FNKVSG-----LKIINVVPGDSGVYSFEVQNPVGKDSCKVS---IQVSDRIIPPSFTRKLKETNG 8706

  Fly   169 KTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRA 233
            .:||.:.:.||:...|..  ::.|:.     ||   |||.|..   :.:...||. |..|.:...
Mouse  8707 LSGSSVVMECKVYGSPPI--SVLWFH-----DG---NEISSGR---KYQTTLTDN-TCALTVNML 8757

  Fly   234 MPGDTGNYTCVPT-VAKTSSVYVHVIIGEHPAAMQ 267
            ...|.|:|||:.| ||.:......:.:.|.|:.:|
Mouse  8758 EEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQ 8792

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/98 (26%)
IG_like 60..150 CDD:214653 25/93 (27%)
IG_like 163..257 CDD:214653 26/100 (26%)
Ig 174..244 CDD:143165 18/69 (26%)
TtnNP_001372637.1 IgI_1_Titin_Z1z2-like 6..98 CDD:409566
Ig strand B 23..27 CDD:409566
Ig strand C 36..40 CDD:409566
Ig strand E 63..67 CDD:409566
Ig strand F 77..82 CDD:409566
Ig strand G 90..93 CDD:409566
IgI_2_Titin_Z1z2-like 103..193 CDD:409564
Ig strand B 121..125 CDD:409564
Ig strand C 134..138 CDD:409564
Ig strand E 159..163 CDD:409564
Ig strand F 173..178 CDD:409564
Ig strand G 186..189 CDD:409564
PRK12323 <253..>346 CDD:237057
Titin_Z 465..504 CDD:401109
Titin_Z 511..548 CDD:401109
Titin_Z 555..594 CDD:401109
Titin_Z 601..640 CDD:401109
Titin_Z 647..685 CDD:401109
Ig strand A 945..948 CDD:409353
I-set 946..1035 CDD:400151
Ig strand A' 951..955 CDD:409353
Ig strand B 963..971 CDD:409353
Ig strand C 976..981 CDD:409353
Ig strand C' 984..986 CDD:409353
Ig strand D 992..997 CDD:409353
Ig strand E 1000..1005 CDD:409353
Ig strand F 1014..1022 CDD:409353
Ig strand G 1025..1035 CDD:409353
I-set 1084..1173 CDD:400151
Ig strand A 1084..1087 CDD:409353
Ig strand A' 1090..1095 CDD:409353
Ig strand B 1100..1107 CDD:409353
Ig strand C 1114..1120 CDD:409353
Ig strand C' 1121..1124 CDD:409353
Ig strand D 1130..1137 CDD:409353
Ig strand E 1140..1150 CDD:409353
Ig strand F 1154..1162 CDD:409353
Ig strand G 1164..1173 CDD:409353
Ig 1295..1383 CDD:416386
Ig strand A' 1299..1304 CDD:409353
Ig strand B 1309..1316 CDD:409353
Ig strand C 1323..1329 CDD:409353
Ig strand C' 1330..1333 CDD:409353
Ig strand D 1339..1345 CDD:409353
Ig strand E 1348..1358 CDD:409353
Ig strand F 1362..1370 CDD:409353
Ig strand G 1372..1383 CDD:409353
Ig 1463..1553 CDD:416386
Ig strand A 1463..1466 CDD:409353
Ig strand A' 1469..1474 CDD:409353
Ig strand B 1479..1486 CDD:409353
Ig strand C 1493..1499 CDD:409353
Ig strand C' 1500..1503 CDD:409353
Ig strand D 1509..1515 CDD:409353
Ig strand E 1518..1528 CDD:409353
Ig strand F 1532..1540 CDD:409353
Ig strand G 1542..1553 CDD:409353
Ig 1562..1653 CDD:416386
Ig strand A 1562..1564 CDD:409353
Ig strand A' 1566..1572 CDD:409353
Ig strand B 1579..1586 CDD:409353
Ig strand C 1592..1597 CDD:409353
Ig strand C' 1599..1602 CDD:409353
Ig strand D 1610..1613 CDD:409353
Ig strand E 1618..1625 CDD:409353
Ig strand F 1632..1640 CDD:409353
Ig strand G 1643..1654 CDD:409353
Ig <1728..1800 CDD:416386
Ig strand C 1741..1746 CDD:409353
Ig strand C' 1749..1751 CDD:409353
Ig strand D 1757..1762 CDD:409353
Ig strand E 1765..1770 CDD:409353
Ig strand F 1779..1787 CDD:409353
Ig strand G 1790..1800 CDD:409353
I-set 1847..1935 CDD:400151
Ig strand A 1847..1849 CDD:409353
Ig strand A' 1851..1857 CDD:409353
Ig strand B 1864..1871 CDD:409353
Ig strand C 1877..1882 CDD:409353
Ig strand C' 1884..1887 CDD:409353
Ig strand E 1900..1907 CDD:409353
Ig strand F 1914..1922 CDD:409353
Ig strand G 1925..1936 CDD:409353
IgI_titin_I1-like 2084..2175 CDD:409543
Ig strand B 2101..2105 CDD:409543
Ig strand C 2114..2118 CDD:409543
Ig strand E 2140..2144 CDD:409543
Ig strand F 2154..2159 CDD:409543
Ig strand G 2167..2170 CDD:409543
Ig 2182..2268 CDD:416386
Ig strand A 2184..2186 CDD:409353
Ig strand A' 2189..2193 CDD:409353
Ig strand B 2197..2203 CDD:409353
Ig strand C 2210..2215 CDD:409353
Ig strand C' 2218..2221 CDD:409353
Ig strand D 2226..2231 CDD:409353
Ig strand E 2234..2239 CDD:409353
Ig strand F 2248..2253 CDD:409353
Ig 2274..2358 CDD:416386
Ig strand A' 2279..2284 CDD:409353
Ig strand B 2289..2296 CDD:409353
Ig strand C 2299..2308 CDD:409353
Ig strand C' 2309..2312 CDD:409353
Ig strand D 2318..2324 CDD:409353
Ig strand E 2326..2336 CDD:409353
Ig 2363..2434 CDD:416386
Ig strand A' 2368..2373 CDD:409353
Ig strand B 2378..2385 CDD:409353
Ig strand C 2391..2397 CDD:409353
Ig strand C' 2398..2401 CDD:409353
Ig strand D 2407..2413 CDD:409353
Ig strand E 2415..2425 CDD:409353
Ig 2453..2536 CDD:416386
Ig strand A' 2460..2463 CDD:409353
Ig strand B 2467..2473 CDD:409353
Ig strand C 2481..2486 CDD:409353
Ig strand C' 2489..2492 CDD:409353
Ig strand D 2497..2502 CDD:409353
Ig strand E 2505..2510 CDD:409353
Ig strand F 2519..2525 CDD:409353
Ig strand G 2528..2536 CDD:409353
Ig 2540..2623 CDD:416386
Ig strand C 2568..2573 CDD:409353
Ig strand C' 2576..2579 CDD:409353
Ig strand D 2584..2589 CDD:409353
Ig strand E 2592..2597 CDD:409353
Ig strand F 2606..2612 CDD:409353
Ig strand G 2615..2623 CDD:409353
Ig 2628..2710 CDD:416386
Ig strand C 2655..2660 CDD:409353
Ig strand C' 2663..2666 CDD:409353
Ig strand D 2671..2676 CDD:409353
Ig strand E 2679..2684 CDD:409353
Ig strand F 2693..2699 CDD:409353
Ig strand G 2702..2710 CDD:409353
Ig 2714..2798 CDD:416386
Ig strand A' 2717..2723 CDD:409353
Ig strand B 2730..2737 CDD:409353
Ig strand C 2743..2748 CDD:409353
Ig strand C' 2750..2753 CDD:409353
Ig strand D 2758..2762 CDD:409353
Ig strand E 2767..2774 CDD:409353
Ig strand G 2788..2799 CDD:409353
Ig 2802..2885 CDD:416386
Ig strand A' 2807..2812 CDD:409353
Ig strand B 2817..2824 CDD:409353
Ig strand C 2831..2836 CDD:409353
Ig strand C' 2837..2840 CDD:409353
Ig strand D 2846..2851 CDD:409353
Ig strand E 2854..2864 CDD:409353
Ig strand G 2875..2885 CDD:409353
Ig 2889..2972 CDD:416386
Ig strand A' 2892..2898 CDD:409353
Ig strand B 2905..2912 CDD:409353
Ig strand C 2918..2922 CDD:409353
Ig strand C' 2924..2927 CDD:409353
Ig strand D 2932..2936 CDD:409353
Ig strand E 2941..2948 CDD:409353
Ig strand F 2955..2963 CDD:409353
Ig 2977..3059 CDD:416386
Ig strand A' 2979..2985 CDD:409353
Ig strand B 2992..3001 CDD:409353
Ig strand C 3004..3009 CDD:409353
Ig strand C' 3011..3014 CDD:409353
Ig strand D 3019..3023 CDD:409353
Ig strand E 3028..3035 CDD:409353
Ig strand G 3049..3060 CDD:409353
I-set 3065..3148 CDD:400151
Ig strand A' 3068..3074 CDD:409353
Ig strand B 3081..3088 CDD:409353
Ig strand C 3093..3098 CDD:409353
Ig strand C' 3100..3103 CDD:409353
Ig strand E 3117..3124 CDD:409353
Ig strand G 3138..3149 CDD:409353
Ig 3159..3239 CDD:416386
Ig strand A' 3161..3165 CDD:409353
Ig strand B 3169..3175 CDD:409353
Ig strand C 3182..3187 CDD:409353
Ig strand C' 3190..3193 CDD:409353
Ig strand D 3198..3203 CDD:409353
Ig strand E 3206..3213 CDD:409353
Ig strand F 3222..3228 CDD:409353
Ig strand G 3231..3239 CDD:409353
Ig 3245..3335 CDD:416386
Ig strand A 3245..3247 CDD:409353
Ig strand A' 3249..3255 CDD:409353
Ig strand B 3262..3269 CDD:409353
Ig strand C 3275..3280 CDD:409353
Ig strand C' 3282..3285 CDD:409353
Ig strand D 3290..3294 CDD:409353
Ig strand E 3299..3306 CDD:409353
Ig strand F 3313..3321 CDD:409353
Ig strand G 3324..3335 CDD:409353
Ig strand A 3350..3353 CDD:409353
I-set 3351..3437 CDD:400151
Ig strand A' 3356..3360 CDD:409353
Ig strand B 3368..3376 CDD:409353
Ig strand C 3380..3385 CDD:409353
Ig strand C' 3388..3390 CDD:409353
Ig strand D 3396..3401 CDD:409353
Ig strand E 3404..3409 CDD:409353
Ig strand F 3418..3426 CDD:409353
Ig strand G 3429..3437 CDD:409353
I-set 3471..3562 CDD:400151
Ig strand A 3471..3473 CDD:409353
Ig strand A' 3475..3481 CDD:409353
Ig strand B 3488..3495 CDD:409353
Ig strand C 3501..3506 CDD:409353
Ig strand C' 3508..3511 CDD:409353
Ig strand D 3518..3522 CDD:409353
Ig strand E 3527..3534 CDD:409353
Ig strand F 3541..3549 CDD:409353
Ig strand G 3552..3562 CDD:409353
I-set 3634..3721 CDD:400151
Ig strand A 3634..3637 CDD:409353
Ig strand A' 3640..3645 CDD:409353
Ig strand B 3650..3657 CDD:409353
Ig strand C 3664..3670 CDD:409353
Ig strand C' 3671..3674 CDD:409353
Ig strand D 3679..3685 CDD:409353
Ig strand E 3688..3698 CDD:409353
Ig strand F 3702..3710 CDD:409353
Ig strand G 3712..3723 CDD:409353
I-set 3750..3840 CDD:400151
Ig strand B 3765..3774 CDD:409353
Ig strand C 3779..3785 CDD:409353
Ig strand C' 3788..3790 CDD:409353
Ig strand D 3796..3801 CDD:409353
Ig strand E 3804..3812 CDD:409353
Ig strand F 3820..3827 CDD:409353
Ig strand G 3830..3840 CDD:409353
Ig 4376..4463 CDD:416386
Ig strand A 4376..4379 CDD:409353
Ig strand A' 4382..4387 CDD:409353
Ig strand B 4392..4399 CDD:409353
Ig strand C 4404..4410 CDD:409353
Ig strand C' 4411..4414 CDD:409353
Ig strand D 4420..4426 CDD:409353
Ig strand E 4429..4438 CDD:409353
Ig strand F 4442..4450 CDD:409353
Ig strand G 4452..4463 CDD:409353
I-set 4469..4558 CDD:400151
Ig strand A 4469..4471 CDD:409353
Ig strand A' 4473..4479 CDD:409353
Ig strand B 4486..4493 CDD:409353
Ig strand C 4499..4504 CDD:409353
Ig strand C' 4506..4509 CDD:409353
Ig strand D 4514..4518 CDD:409353
Ig strand E 4523..4530 CDD:409353
Ig strand F 4537..4545 CDD:409353
Ig strand G 4548..4558 CDD:409353
I-set 4564..4653 CDD:400151
Ig strand A 4564..4567 CDD:409353
Ig strand A' 4570..4575 CDD:409353
Ig strand B 4580..4587 CDD:409353
Ig strand C 4594..4600 CDD:409353
Ig strand C' 4601..4604 CDD:409353
Ig strand D 4609..4615 CDD:409353
Ig strand E 4618..4628 CDD:409353
Ig strand F 4632..4640 CDD:409353
Ig strand G 4642..4653 CDD:409353
Ig 4657..4730 CDD:416386
Ig strand B 4674..4678 CDD:409353
Ig strand C 4687..4691 CDD:409353
Ig strand E 4712..4716 CDD:409353
Ig strand F 4726..4730 CDD:409353
I-set 4750..4840 CDD:400151
Ig strand B 4768..4772 CDD:409353
Ig strand C 4781..4785 CDD:409353
Ig strand E 4806..4810 CDD:409353
Ig strand F 4820..4825 CDD:409353
I-set 4844..4930 CDD:400151
Ig strand B 4861..4865 CDD:409353
Ig strand C 4874..4878 CDD:409353
Ig strand E 4899..4903 CDD:409353
Ig strand F 4913..4918 CDD:409353
I-set 4937..5026 CDD:400151
Ig strand A 4937..4939 CDD:409353
Ig strand A' 4942..4947 CDD:409353
Ig strand B 4954..4962 CDD:409353
Ig strand C 4967..4971 CDD:409353
Ig strand C' 4975..4977 CDD:409353
Ig strand D 4982..4988 CDD:409353
Ig strand E 4991..4996 CDD:409353
Ig strand F 5005..5013 CDD:409353
Ig strand G 5016..5027 CDD:409353
I-set 5039..5119 CDD:400151
Ig strand B 5047..5051 CDD:409353
Ig strand C 5060..5064 CDD:409353
Ig strand E 5085..5089 CDD:409353
Ig strand F 5099..5104 CDD:409353
Ig strand G 5113..5116 CDD:409353
I-set 5126..5215 CDD:400151
Ig strand B 5144..5147 CDD:409353
Ig strand C 5156..5160 CDD:409353
Ig strand E 5181..5185 CDD:409353
Ig strand F 5195..5200 CDD:409353
Ig strand G 5209..5212 CDD:409353
Ig strand A 5218..5221 CDD:409353
I-set 5219..5308 CDD:400151
Ig strand A' 5224..5228 CDD:409353
Ig strand B 5236..5244 CDD:409353
Ig strand C 5249..5254 CDD:409353
Ig strand C' 5257..5259 CDD:409353
Ig strand D 5265..5270 CDD:409353
Ig strand E 5273..5278 CDD:409353
Ig strand F 5287..5295 CDD:409353
Ig strand G 5298..5308 CDD:409353
I-set 5314..5402 CDD:400151
Ig strand A' 5318..5323 CDD:409353
Ig strand B 5329..5336 CDD:409353
Ig strand C 5343..5349 CDD:409353
Ig strand C' 5350..5353 CDD:409353
Ig strand D 5359..5365 CDD:409353
Ig strand E 5368..5377 CDD:409353
Ig strand F 5381..5389 CDD:409353
I-set 5406..5494 CDD:400151
Ig strand B 5423..5427 CDD:409353
Ig strand C 5436..5440 CDD:409353
Ig strand E 5461..5465 CDD:409353
Ig strand F 5475..5480 CDD:409353
Ig 5499..5588 CDD:416386
Ig strand C 5529..5533 CDD:409353
Ig strand E 5554..5558 CDD:409353
Ig strand F 5568..5573 CDD:409353
Ig 5600..5681 CDD:416386
Ig strand A 5601..5604 CDD:409353
Ig strand B 5609..5615 CDD:409353
Ig strand C 5621..5627 CDD:409353
Ig strand D 5639..5644 CDD:409353
Ig strand E 5645..5651 CDD:409353
Ig strand F 5660..5668 CDD:409353
Ig strand G 5671..5681 CDD:409353
I-set 5688..5777 CDD:400151
Ig strand C 5718..5722 CDD:409353
Ig strand E 5743..5747 CDD:409353
Ig strand F 5757..5762 CDD:409353
Ig strand A 5780..5783 CDD:409353
Ig 5781..5870 CDD:416386
Ig strand A' 5786..5790 CDD:409353
Ig strand B 5798..5806 CDD:409353
Ig strand C 5811..5816 CDD:409353
Ig strand C' 5819..5821 CDD:409353
Ig strand D 5827..5832 CDD:409353
Ig strand E 5835..5840 CDD:409353
Ig strand F 5849..5857 CDD:409353
Ig strand G 5860..5870 CDD:409353
I-set 5874..5964 CDD:400151
Ig strand B 5893..5896 CDD:409353
Ig strand C 5905..5909 CDD:409353
Ig strand E 5930..5934 CDD:409353
Ig strand F 5944..5949 CDD:409353
Ig strand G 5957..5960 CDD:409353
I-set 5968..6056 CDD:400151
Ig strand A 5968..5970 CDD:409353
Ig strand A' 5972..5978 CDD:409353
Ig strand B 5985..5992 CDD:409353
Ig strand C 5998..6003 CDD:409353
Ig strand C' 6005..6008 CDD:409353
Ig strand D 6013..6017 CDD:409353
Ig strand E 6022..6029 CDD:409353
Ig strand F 6036..6044 CDD:409353
Ig strand G 6047..6058 CDD:409353
I-set 6061..6150 CDD:400151
Ig strand B 6078..6082 CDD:409353
Ig strand C 6091..6095 CDD:409353
Ig strand E 6116..6120 CDD:409353
Ig strand F 6130..6135 CDD:409353
I-set 6155..6243 CDD:400151
Ig strand B 6171..6175 CDD:409353
Ig strand C 6184..6188 CDD:409353
Ig strand E 6209..6213 CDD:409353
Ig strand F 6223..6228 CDD:409353
Ig strand A 6249..6252 CDD:409353
I-set 6250..6339 CDD:400151
Ig strand A' 6255..6259 CDD:409353
Ig strand B 6267..6275 CDD:409353
Ig strand C 6280..6285 CDD:409353
Ig strand C' 6288..6290 CDD:409353
Ig strand D 6296..6301 CDD:409353
Ig strand E 6304..6309 CDD:409353
Ig strand F 6318..6326 CDD:409353
Ig strand G 6329..6339 CDD:409353
Ig strand A 6342..6345 CDD:409353
I-set 6343..6432 CDD:400151
Ig strand A' 6348..6352 CDD:409353
Ig strand B 6360..6368 CDD:409353
Ig strand C 6373..6378 CDD:409353
Ig strand C' 6381..6383 CDD:409353
Ig strand D 6389..6394 CDD:409353
Ig strand E 6397..6402 CDD:409353
Ig strand F 6411..6419 CDD:409353
Ig strand G 6422..6432 CDD:409353
I-set 6436..6526 CDD:400151
Ig strand A 6436..6439 CDD:409353
Ig strand A' 6442..6447 CDD:409353
Ig strand B 6453..6460 CDD:409353
Ig strand C 6467..6473 CDD:409353
Ig strand C' 6474..6477 CDD:409353
Ig strand D 6483..6489 CDD:409353
Ig strand E 6491..6501 CDD:409353
Ig strand F 6505..6513 CDD:409353
Ig strand G 6515..6526 CDD:409353
I-set 6530..6618 CDD:400151
Ig strand B 6547..6551 CDD:409353
Ig strand C 6560..6564 CDD:409353
Ig strand E 6585..6589 CDD:409353
Ig strand F 6599..6604 CDD:409353
Ig strand A 6622..6626 CDD:409353
I-set 6623..6713 CDD:400151
Ig strand A' 6631..6635 CDD:409353
Ig strand B 6639..6648 CDD:409353
Ig strand C 6652..6658 CDD:409353
Ig strand C' 6661..6664 CDD:409353
Ig strand D 6670..6675 CDD:409353
Ig strand E 6679..6684 CDD:409353
Ig strand F 6692..6700 CDD:409353
Ig strand G 6703..6713 CDD:409353
I-set 6718..6806 CDD:400151
Ig strand C 6747..6751 CDD:409353
Ig strand E 6772..6776 CDD:409353
Ig strand F 6786..6791 CDD:409353
Ig strand G 6800..6803 CDD:409353
I-set 6813..6902 CDD:400151
Ig strand C 6843..6847 CDD:409353
Ig strand E 6868..6872 CDD:409353
Ig strand F 6882..6887 CDD:409353
Ig strand A 6905..6908 CDD:409353
I-set 6906..6995 CDD:400151
Ig strand A' 6914..6917 CDD:409353
Ig strand B 6922..6930 CDD:409353
Ig strand C 6936..6940 CDD:409353
Ig strand C' 6943..6946 CDD:409353
Ig strand D 6951..6957 CDD:409353
Ig strand E 6961..6966 CDD:409353
Ig strand F 6974..6982 CDD:409353
Ig strand G 6985..6995 CDD:409353
I-set 7001..7086 CDD:400151
Ig strand B 7016..7020 CDD:409353
Ig strand C 7029..7033 CDD:409353
Ig strand E 7054..7058 CDD:409353
Ig strand F 7068..7073 CDD:409353
I-set 7092..7173 CDD:400151
Ig strand B 7109..7113 CDD:409353
Ig strand C 7122..7126 CDD:409353
Ig strand E 7147..7151 CDD:409353
Ig strand F 7161..7166 CDD:409353
Ig strand G 7175..7178 CDD:409353
I-set 7188..7276 CDD:400151
Ig strand B 7205..7209 CDD:409353
Ig strand C 7218..7222 CDD:409353
Ig strand E 7243..7247 CDD:409353
Ig strand F 7257..7262 CDD:409353
I-set 7284..7373 CDD:400151
Ig strand A 7284..7287 CDD:409353
Ig strand A' 7290..7295 CDD:409353
Ig strand B 7300..7307 CDD:409353
Ig strand C 7314..7320 CDD:409353
Ig strand C' 7321..7324 CDD:409353
Ig strand D 7330..7336 CDD:409353
Ig strand E 7339..7348 CDD:409353
Ig strand F 7352..7360 CDD:409353
Ig strand G 7362..7373 CDD:409353
Ig strand A 7376..7379 CDD:409353
I-set 7377..7467 CDD:400151
Ig strand A' 7382..7386 CDD:409353
Ig strand B 7395..7403 CDD:409353
Ig strand C 7408..7413 CDD:409353
Ig strand C' 7416..7418 CDD:409353
Ig strand D 7424..7429 CDD:409353
Ig strand E 7432..7437 CDD:409353
Ig strand F 7446..7454 CDD:409353
Ig strand G 7457..7467 CDD:409353
Ig strand A 7470..7473 CDD:409353
I-set 7471..7559 CDD:400151
Ig strand A' 7476..7480 CDD:409353
Ig strand B 7488..7496 CDD:409353
Ig strand C 7501..7506 CDD:409353
Ig strand C' 7509..7511 CDD:409353
Ig strand D 7517..7522 CDD:409353
Ig strand E 7525..7530 CDD:409353
Ig strand F 7539..7547 CDD:409353
Ig strand A 7563..7567 CDD:409353
I-set 7564..7654 CDD:400151
Ig strand A' 7572..7576 CDD:409353
Ig strand B 7580..7589 CDD:409353
Ig strand C 7593..7599 CDD:409353
Ig strand C' 7602..7605 CDD:409353
Ig strand D 7611..7616 CDD:409353
Ig strand E 7620..7625 CDD:409353
Ig strand F 7633..7641 CDD:409353
Ig strand G 7644..7660 CDD:409353
Ig strand A 7657..7664 CDD:409353
I-set 7660..7747 CDD:400151
Ig strand A' 7665..7670 CDD:409353
Ig strand B 7675..7683 CDD:409353
Ig strand C 7687..7693 CDD:409353
Ig strand C' 7695..7697 CDD:409353
Ig strand D 7703..7709 CDD:409353
Ig strand E 7712..7718 CDD:409353
Ig strand F 7727..7734 CDD:409353
Ig strand A 7753..7756 CDD:409353
I-set 7754..7843 CDD:400151
Ig strand A' 7759..7763 CDD:409353
Ig strand B 7771..7779 CDD:409353
Ig strand C 7784..7789 CDD:409353
Ig strand C' 7792..7794 CDD:409353
Ig strand D 7800..7805 CDD:409353
Ig strand E 7808..7813 CDD:409353
Ig strand F 7822..7830 CDD:409353
Ig strand G 7833..7843 CDD:409353
Ig strand A 7846..7849 CDD:409353
I-set 7847..7936 CDD:400151
Ig strand A' 7852..7856 CDD:409353
Ig strand B 7864..7872 CDD:409353
Ig strand C 7877..7882 CDD:409353
Ig strand C' 7885..7887 CDD:409353
Ig strand D 7893..7898 CDD:409353
Ig strand E 7901..7906 CDD:409353
Ig strand F 7915..7923 CDD:409353
Ig strand G 7926..7936 CDD:409353
Ig 7942..8029 CDD:416386
Ig strand A' 7944..7950 CDD:409353
Ig strand B 7957..7964 CDD:409353
Ig strand C 7970..7975 CDD:409353
Ig strand C' 7977..7980 CDD:409353
Ig strand D 7985..7989 CDD:409353
Ig strand E 7994..8001 CDD:409353
Ig strand F 8008..8016 CDD:409353
Ig strand G 8019..8029 CDD:409353
I-set 8033..8122 CDD:400151
Ig strand B 8050..8054 CDD:409353
Ig strand C 8063..8067 CDD:409353
Ig strand E 8088..8092 CDD:409353
Ig strand F 8102..8107 CDD:409353
Ig strand G 8116..8119 CDD:409353
I-set 8129..8217 CDD:400151
Ig strand B 8146..8150 CDD:409353
Ig strand C 8159..8163 CDD:409353
Ig strand E 8184..8188 CDD:409353
Ig strand F 8198..8203 CDD:409353
I-set 8225..8314 CDD:400151
Ig strand A 8225..8228 CDD:409353
Ig strand A' 8231..8236 CDD:409353
Ig strand B 8241..8248 CDD:409353
Ig strand C 8255..8261 CDD:409353
Ig strand C' 8262..8265 CDD:409353
Ig strand D 8271..8277 CDD:409353
Ig strand E 8279..8289 CDD:409353
Ig strand F 8293..8301 CDD:409353
Ig strand G 8303..8314 CDD:409353
Ig 8318..8395 CDD:416386
Ig strand C 8349..8353 CDD:409353
Ig strand E 8374..8378 CDD:409353
Ig strand F 8388..8393 CDD:409353
Ig strand A 8411..8414 CDD:409353
I-set 8412..8500 CDD:400151
Ig strand A' 8417..8421 CDD:409353
Ig strand B 8429..8437 CDD:409353
Ig strand C 8442..8447 CDD:409353
Ig strand C' 8450..8452 CDD:409353
Ig strand D 8458..8463 CDD:409353
Ig strand E 8466..8471 CDD:409353
Ig strand F 8480..8488 CDD:409353
Ig strand A 8504..8507 CDD:409353