DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and zig-3

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:108 Identity:26/108 - (24%)
Similarity:42/108 - (38%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 INTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKG 203
            :.|:|.:.:            |.|..|..|.||..:.|.|.::..|  .|.|:|.|..:.:.|..
 Worm    38 LTTKPSLKI------------IEGLEDNTVSTGESVTLRCDVLSTP--TGVIYWEKDGQRIQGDK 88

  Fly   204 ENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT 246
            |..:...:.........:..:||..:|..|.....|:|.||.|
 Worm    89 ELNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVAT 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 2/14 (14%)
IG_like 60..150 CDD:214653 2/10 (20%)
IG_like 163..257 CDD:214653 22/84 (26%)
Ig 174..244 CDD:143165 15/69 (22%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 24/101 (24%)
Ig 61..142 CDD:143165 18/73 (25%)
IG_like 177..244 CDD:214653
Ig <191..237 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.